mRNA_D-mesarthrocarpus_Contig10254.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: D8LGV3_ECTSI (2OG-Fe(II) oxygenase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LGV3_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 3.740e-9 Identity = 27/41 (65.85%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPK 123 R F R+++DH+QKVEF L GSLL+MEG+TQ+HWQH VPK Sbjct: 225 RRFQLRRKKDHAQKVEFILGGGSLLLMEGSTQEHWQHRVPK 265
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A844M3Q7_9GAMM (Alpha-ketoglutarate-dependent dioxygenase AlkB n=3 Tax=Psychrobacter TaxID=497 RepID=A0A844M3Q7_9GAMM) HSP 1 Score: 58.2 bits (139), Expect = 7.010e-9 Identity = 28/42 (66.67%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQ 126 R FL R +EDHS+K+E L GSLLVM G Q HWQHSVPKQ Sbjct: 196 RRFLLRLKEDHSRKIELPLHHGSLLVMAGAIQHHWQHSVPKQ 237
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A0C1F384_9FLAO (DNA repair protein n=1 Tax=Flavobacterium sp. AED TaxID=1423323 RepID=A0A0C1F384_9FLAO) HSP 1 Score: 57.8 bits (138), Expect = 9.260e-9 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQ 126 R FL R+ +DHS K+EF L+ G+LL+M G Q HWQHSVPK+ Sbjct: 190 RRFLLRRNDDHSVKIEFPLKHGTLLIMRGELQHHWQHSVPKE 231
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A5A9ZF46_9GAMM (Alpha-ketoglutarate-dependent dioxygenase AlkB n=1 Tax=Psychrobacter sp. ANT_WB68 TaxID=2597355 RepID=A0A5A9ZF46_9GAMM) HSP 1 Score: 57.4 bits (137), Expect = 1.350e-8 Identity = 27/42 (64.29%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQ 126 R FL R+R+DHS K+E L+ GS+LVM G Q HWQHSVPKQ Sbjct: 197 RRFLLRRRDDHSTKLEIPLQHGSILVMAGALQHHWQHSVPKQ 238
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A6H5J9B1_9PHAE (Fe2OG dioxygenase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J9B1_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 3.050e-8 Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPK 123 R F R R+D +QK+EF L GSLL+MEG+TQ+HWQH VPK Sbjct: 26 RRFELRGRKDRTQKMEFVLGGGSLLLMEGSTQEHWQHRVPK 66
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: UPI001EDE62C6 (alpha-ketoglutarate-dependent dioxygenase AlkB n=2 Tax=unclassified Psychrobacter TaxID=196806 RepID=UPI001EDE62C6) HSP 1 Score: 55.8 bits (133), Expect = 4.980e-8 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQ 126 R FL R+R+DHS K++ L+ GS+LVM G Q HWQHSVPKQ Sbjct: 197 RRFLLRRRDDHSIKLDIPLKHGSILVMAGALQHHWQHSVPKQ 238
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: T2JKF6_CROWT (Alkylated DNA repair protein n=1 Tax=Crocosphaera watsonii WH 0402 TaxID=1284629 RepID=T2JKF6_CROWT) HSP 1 Score: 54.7 bits (130), Expect = 7.190e-8 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPK 123 R F+FR+R+DH K+E KL G LL+M TQK WQH VPK Sbjct: 141 RRFIFRRRDDHGNKIERKLNHGDLLIMRDETQKFWQHQVPK 181
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: UPI001F2DF7C9 (alpha-ketoglutarate-dependent dioxygenase AlkB n=1 Tax=Marinagarivorans sp. GE09 TaxID=2721545 RepID=UPI001F2DF7C9) HSP 1 Score: 54.7 bits (130), Expect = 8.560e-8 Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPK 123 R F+ R + DH+QK F L GSLL+M G+TQ+HWQH+VPK Sbjct: 141 RRFVLRSKHDHTQKRSFHLNHGSLLLMAGDTQQHWQHAVPK 181
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A4Q6BWN5_9PROT (Alpha-ketoglutarate-dependent dioxygenase AlkB n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A4Q6BWN5_9PROT) HSP 1 Score: 54.7 bits (130), Expect = 9.210e-8 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPK 123 R F+ R+R DH+ K+ +L SGSLL+M G TQ HWQH++PK Sbjct: 142 RKFVLRRRADHANKISIELESGSLLLMRGETQAHWQHALPK 182
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Match: A0A839TDJ4_9GAMM (Alkylated DNA repair dioxygenase AlkB n=1 Tax=Psychrobacter luti TaxID=198481 RepID=A0A839TDJ4_9GAMM) HSP 1 Score: 54.7 bits (130), Expect = 1.320e-7 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 1 Query: 1 RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQ 126 R FL R+R++HS K+E L+ GS+LVM G Q HWQHSVPKQ Sbjct: 197 RRFLLRRRDNHSIKLEISLQHGSVLVMAGALQHHWQHSVPKQ 238 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10254.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10254.1.1 >prot_D-mesarthrocarpus_Contig10254.1.1 ID=prot_D-mesarthrocarpus_Contig10254.1.1|Name=mRNA_D-mesarthrocarpus_Contig10254.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=42bp RYFLFRQREDHSQKVEFKLRSGSLLVMEGNTQKHWQHSVPKQback to top mRNA from alignment at D-mesarthrocarpus_Contig10254:59..871+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10254.1.1 ID=mRNA_D-mesarthrocarpus_Contig10254.1.1|Name=mRNA_D-mesarthrocarpus_Contig10254.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=813bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10254:59..871+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10254:59..871+ >mRNA_D-mesarthrocarpus_Contig10254.1.1 ID=mRNA_D-mesarthrocarpus_Contig10254.1.1|Name=mRNA_D-mesarthrocarpus_Contig10254.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=126bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10254:59..871+ (Discosporangium mesarthrocarpum MT17_79)back to top |