mRNA_D-mesarthrocarpus_Contig10225.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10225.1.1 vs. uniprot
Match: D8LIJ2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LIJ2_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 3.950e-13 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 1 Query: 19 SLRGSHNASCPCSILFNTSSLELSGAISSLGEMVTTGEGTEVAVWSFNQ 165 SLRG NASCPC+I+FNTSSL L GAIS+ GE+ T EGTEVAVWSF+Q Sbjct: 502 SLRG-ENASCPCTIVFNTSSLSLEGAISAAGELALTAEGTEVAVWSFDQ 549
BLAST of mRNA_D-mesarthrocarpus_Contig10225.1.1 vs. uniprot
Match: A0A835YHE6_9STRA (2Fe-2S ferredoxin-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YHE6_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 5.700e-8 Identity = 28/52 (53.85%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 19 SLRGSHNASCPCSILFNTSSLELSGAISSLGEMVTT-GEGTEVAVWSFNQAR 171 SL + A+CPC +LFNTSSL+L+GA+++ +VT G G E AVWSF Q R Sbjct: 530 SLAAAAAAACPCRLLFNTSSLQLTGAVNATATLVTAPGSGAETAVWSFEQVR 581
BLAST of mRNA_D-mesarthrocarpus_Contig10225.1.1 vs. uniprot
Match: A0A7S2RHA5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2RHA5_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 4.910e-7 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 1 Query: 52 CSILFNTSSLELSGAISSLGEMVTTGEGTEVAVWSFN 162 CS+LFNTSSLEL GA+++ G + T +GTE+AVWSF+ Sbjct: 2 CSLLFNTSSLELKGAVNATGTVSITPDGTEIAVWSFD 38
BLAST of mRNA_D-mesarthrocarpus_Contig10225.1.1 vs. uniprot
Match: A0A7S2LHA4_9STRA (Hypothetical protein n=2 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2LHA4_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 6.240e-6 Identity = 22/49 (44.90%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 16 QSLRGSHNASCPCSILFNTSSLELSGAISSLGEMVTTGEGTEVAVWSFN 162 Q+L S + C ++FNTSSL+L+GA+++ G +VT +GTE+A+W+F+ Sbjct: 494 QTLSSSQCVNTLCELVFNTSSLDLTGAVNATGTLVTQDDGTEIALWAFD 542 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10225.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10225.1.1 >prot_D-mesarthrocarpus_Contig10225.1.1 ID=prot_D-mesarthrocarpus_Contig10225.1.1|Name=mRNA_D-mesarthrocarpus_Contig10225.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=60bp MAGEKQSLRGSHNASCPCSILFNTSSLELSGAISSLGEMVTTGEGTEVAVback to top mRNA from alignment at D-mesarthrocarpus_Contig10225:678..857- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10225.1.1 ID=mRNA_D-mesarthrocarpus_Contig10225.1.1|Name=mRNA_D-mesarthrocarpus_Contig10225.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=180bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10225:678..857- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10225:678..857- >mRNA_D-mesarthrocarpus_Contig10225.1.1 ID=mRNA_D-mesarthrocarpus_Contig10225.1.1|Name=mRNA_D-mesarthrocarpus_Contig10225.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=180bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10225:678..857- (Discosporangium mesarthrocarpum MT17_79)back to top |