mRNA_D-mesarthrocarpus_Contig10202.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10202.1.1 vs. uniprot
Match: D7FHF2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHF2_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 5.460e-13 Identity = 32/52 (61.54%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 13 QASDPVSLCTQCMPPWVRGLTETFPGLFSLEERLSLMKKTAFGRARAVTSVQ 168 QA +P++LCT +P W GL FP LFSLE RLSL++KTAFG ARAV VQ Sbjct: 8 QACNPLALCTGSLPSWCVGLPREFPSLFSLETRLSLLRKTAFGMARAVAHVQ 59
BLAST of mRNA_D-mesarthrocarpus_Contig10202.1.1 vs. uniprot
Match: A0A6H5K2P5_9PHAE (HECT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2P5_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.920e-11 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 13 QASDPVSLCTQCMPPWVRGLTETFPGLFSLEERLSLMKKTAFGRARAVTSVQ 168 +A +P++LCT +P W GL FP LFSLE RLSL++KTAFG ARAV VQ Sbjct: 1469 KACNPLALCTGSLPSWCVGLPREFPSLFSLETRLSLLRKTAFGMARAVAHVQ 1520 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10202.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10202.1.1 >prot_D-mesarthrocarpus_Contig10202.1.1 ID=prot_D-mesarthrocarpus_Contig10202.1.1|Name=mRNA_D-mesarthrocarpus_Contig10202.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=58bp RVIIQASDPVSLCTQCMPPWVRGLTETFPGLFSLEERLSLMKKTAFGRARback to top mRNA from alignment at D-mesarthrocarpus_Contig10202:102..275+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10202.1.1 ID=mRNA_D-mesarthrocarpus_Contig10202.1.1|Name=mRNA_D-mesarthrocarpus_Contig10202.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=174bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10202:102..275+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10202:102..275+ >mRNA_D-mesarthrocarpus_Contig10202.1.1 ID=mRNA_D-mesarthrocarpus_Contig10202.1.1|Name=mRNA_D-mesarthrocarpus_Contig10202.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=174bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10202:102..275+ (Discosporangium mesarthrocarpum MT17_79)back to top |