mRNA_D-mesarthrocarpus_Contig1020.2.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: D7FKM6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKM6_ECTSI) HSP 1 Score: 101 bits (251), Expect = 6.220e-22 Identity = 47/64 (73.44%), Postives = 55/64 (85.94%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSALADRS 192 MEPGAGGGDFKFLRGFDPA+V+S H+C HPGL AV FL EER +IDE ++YLTE+SALADR+ Sbjct: 466 MEPGAGGGDFKFLRGFDPAIVNSCHYCTHPGLRGAVDSFLDEERASIDEYDQYLTERSALADRT 529
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A835YP59_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YP59_9STRA) HSP 1 Score: 90.1 bits (222), Expect = 5.400e-18 Identity = 45/65 (69.23%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSALADRSG 195 MEPGAGGGDFKFLRGFDPAVV S H C +P L AAVA FLR ER+ IDE+ EYL +SA+ R G Sbjct: 471 MEPGAGGGDFKFLRGFDPAVVHSAHACLNPMLHAAVAGFLRREREHIDESAEYLMHRSAVGKRQG 535
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A6T6L5G9_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A6T6L5G9_9RHOD) HSP 1 Score: 70.5 bits (171), Expect = 1.600e-12 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSALADRS 192 MEPGAGG DFKF+RGF+P+V +S+HFC + GL A+AR+L E I+ A + + E+S L +S Sbjct: 63 MEPGAGGDDFKFVRGFNPSVTNSMHFCKNGGLHMAIARYLNSEGSYIEGAVDEMNERSVLRKQS 126
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A7S1DCA9_CYCTE (Hypothetical protein n=1 Tax=Cyclophora tenuis TaxID=216820 RepID=A0A7S1DCA9_CYCTE) HSP 1 Score: 73.9 bits (180), Expect = 2.000e-12 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSAL 180 MEPGAGGGD+K+ RGFDPA+V S H+ +HPGL AV FL E + E ++YLT++SA+ Sbjct: 347 MEPGAGGGDYKWARGFDPALVHSAHYISHPGLRKAVREFLNYETENNVELQQYLTDRSAV 406
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A1Z5K6A3_FISSO (Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K6A3_FISSO) HSP 1 Score: 73.6 bits (179), Expect = 3.120e-12 Identity = 34/63 (53.97%), Postives = 47/63 (74.60%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSALADR 189 MEPGAGGGD+K+ RGFDPA++ SVH+ HPGL AV +FL +E + E ++L E+SA+ +R Sbjct: 471 MEPGAGGGDYKWARGFDPALIHSVHYICHPGLRRAVGQFLIDETENNVELTKFLLERSAVGNR 533
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A6V1WMU1_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1WMU1_HETAK) HSP 1 Score: 73.2 bits (178), Expect = 4.060e-12 Identity = 35/60 (58.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSAL 180 MEPGAGGGDFKF+RGFDPA S HF + GL AV R L EE ++ +EA EYL +S++ Sbjct: 375 MEPGAGGGDFKFMRGFDPAPTRSAHFIENKGLRLAVQRSLGEEEESFNEAAEYLNRQSSM 434
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: K8YNM4_NANGC (Uncharacterized protein n=4 Tax=Monodopsidaceae TaxID=425072 RepID=K8YNM4_NANGC) HSP 1 Score: 71.6 bits (174), Expect = 1.430e-11 Identity = 39/74 (52.70%), Postives = 48/74 (64.86%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSALADRSGRTSGGIKGG 222 MEPGAG DFKF+RGF+P V S+H HPGL AV FL+ ER+ + EYL+EKSA+ R R G +GG Sbjct: 429 MEPGAGNSDFKFMRGFEPVHVHSMHHLVHPGLRQAVDDFLQYERREVSGTVEYLSEKSAVRGR--RDGQGGEGG 500
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A7S3EGM6_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3EGM6_9RHOD) HSP 1 Score: 69.3 bits (168), Expect = 1.790e-11 Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSAL 180 MEPGAGG DFKF+RGF+P+V +S+HFC + GL A+AR+L E I+ A + + E+S L Sbjct: 134 MEPGAGGDDFKFVRGFNPSVTNSMHFCKNGGLHMAIARYLNSEGTYIEGAVDEMNERSVL 193
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A7S3EFK2_9RHOD (Hypothetical protein n=3 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3EFK2_9RHOD) HSP 1 Score: 69.3 bits (168), Expect = 8.640e-11 Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSAL 180 MEPGAGG DFKF+RGF+P+V +S+HFC + GL A+AR+L E I+ A + + E+S L Sbjct: 366 MEPGAGGDDFKFVRGFNPSVTNSMHFCKNGGLHMAIARYLNSEGTYIEGAVDEMNERSVL 425
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Match: A0A0G4F6M4_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4F6M4_VITBC) HSP 1 Score: 65.5 bits (158), Expect = 1.960e-9 Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 1 Query: 1 MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAEEYLTEKSAL--ADRS 192 M+PGAGGGDFKF+RG+DPA+ S HF P L A+ FL ER + + L EK+ + ADRS Sbjct: 383 MQPGAGGGDFKFMRGYDPAICHSSHFIVRPELRRAIRAFLEMERDRVQMVADELNEKTKVRGADRS 448 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig1020.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 22 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig1020.2.1 >prot_D-mesarthrocarpus_Contig1020.2.1 ID=prot_D-mesarthrocarpus_Contig1020.2.1|Name=mRNA_D-mesarthrocarpus_Contig1020.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=92bp MEPGAGGGDFKFLRGFDPAVVSSVHFCAHPGLGAAVARFLREERQAIDEAback to top mRNA from alignment at D-mesarthrocarpus_Contig1020:2980..9256+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig1020.2.1 ID=mRNA_D-mesarthrocarpus_Contig1020.2.1|Name=mRNA_D-mesarthrocarpus_Contig1020.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=6277bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig1020:2980..9256+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig1020:2980..9256+ >mRNA_D-mesarthrocarpus_Contig1020.2.1 ID=mRNA_D-mesarthrocarpus_Contig1020.2.1|Name=mRNA_D-mesarthrocarpus_Contig1020.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=276bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig1020:2980..9256+ (Discosporangium mesarthrocarpum MT17_79)back to top |