mRNA_D-mesarthrocarpus_Contig10171.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A7S2PB29_9STRA (Hypothetical protein n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2PB29_9STRA) HSP 1 Score: 82.0 bits (201), Expect = 3.290e-16 Identity = 43/85 (50.59%), Postives = 53/85 (62.35%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLGE-CSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWF 252 F L FSI+G + G+LHSRCRLTPYPV L + C S E CW YL+ V S+P + CL EE +DSSWT+ S SPW+ Sbjct: 192 FFLACFSIIGVVFWRGILHSRCRLTPYPVVLFDNCRSQSEQCWEMYLAEVISNPSAYRCLEEE-------TNDSSWTQ-STSPWY 268
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A5D6XG87_9STRA (Uncharacterized protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XG87_9STRA) HSP 1 Score: 63.2 bits (152), Expect = 1.420e-9 Identity = 35/82 (42.68%), Postives = 50/82 (60.98%), Query Frame = 1 Query: 22 ILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 ++G Q++SGVLH RCRLTPYPVRL SV +P+Y + V + P +AC + V N+ +WT S SPW + ++C Sbjct: 261 VIGIQMWSGVLHPRCRLTPYPVRLDP--SVTLATFPEYQAMVLADPSLFACTDDSNSRIPVANE--TWTHES-SPWHKPRLC 337
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A662XKN5_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XKN5_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 4.920e-9 Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 1 Query: 22 ILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 ++G QL+SG +HSRCRL PYP+ L + ED P Y V +PE + CL + G A+E ++ +W+ S SPW + C Sbjct: 332 VIGVQLWSGGMHSRCRLAPYPLAL-DADLQLEDL-PAYQQQVLQTPELFRCLGDGAGATALETENDTWSHDS-SPWRTPRSC 410
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: G4YIT9_PHYSP (Uncharacterized protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4YIT9_PHYSP) HSP 1 Score: 61.2 bits (147), Expect = 6.690e-9 Identity = 34/89 (38.20%), Postives = 53/89 (59.55%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 F+ + ++G QL+SG +HSRCRL+P+P+ L S+ E P Y V ++PE + CL E+ ++ + +SWT S SPW +VC Sbjct: 104 FLFFFYGVIGVQLYSGAMHSRCRLSPHPLALDPNISLKE--LPAYQEQVVAAPELFRCLDEDSL--PLQAEMNSWTHDS-SPWKTPRVC 187
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A2D4CGZ7_PYTIN (Uncharacterized protein n=2 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CGZ7_PYTIN) HSP 1 Score: 61.2 bits (147), Expect = 6.720e-9 Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1 Query: 22 ILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 + G QL+SGVLHSRCRLTP+PV L ++ + P Y S V + P + C + +E D+SSWT + SPW + Q+C Sbjct: 320 VTGVQLWSGVLHSRCRLTPFPVVLDP--NITLESLPDYQSRVVADPYTYRCR-DVKSLDVLELDNSSWTHDT-SPWRQPQLC 397
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A6A3FWU6_9STRA (Uncharacterized protein n=5 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6A3FWU6_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 9.170e-9 Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 F+ + ++G QL+SG +HSRCR++PYP+ L S+ E P Y V ++PE + CL E +E + SW+ S SPW +VC Sbjct: 326 FLFFFYGVIGVQLWSGAMHSRCRMSPYPLALDPNLSLKE--LPAYQEQVVAAPELFRCLGENSL--PLEAETDSWSHDS-SPWKTPRVC 409
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A662WQP6_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662WQP6_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 1.250e-8 Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 1 Query: 22 ILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 ++G QL+SG +HSRCRLTP+P+ L + ED P Y V +PE + CL + G A+E ++ +W+ S SPW C Sbjct: 391 VIGVQLWSGGMHSRCRLTPFPLAL-DADLQLEDL-PAYQQQVLQTPELFRCLGDGAGATALEIENDTWSHDS-SPWRTPHSC 469
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A662XXG8_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XXG8_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 1.580e-8 Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 F+ ++ I+G QL+SGVLH RCRLTP+P+RL ++V D +P Y S ++ + C+ E + +SW+ S SPW +VC Sbjct: 34 FLFFLYGIIGVQLWSGVLHPRCRLTPWPLRLD--ANVTPDDFPAYQSMALANVSLYTCVDESNT--QIPLSQASWSHDS-SPWRTPRVC 117
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: F0WCG7_9STRA (Similar to sodium channel putative n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0WCG7_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 3.200e-8 Identity = 37/96 (38.54%), Postives = 55/96 (57.29%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLG-ECSSVYEDCWP---QYLSNVSSSPEDWACLLEEGGGGAVENDDSS---WTRRSDSPWFEAQVC 267 F+ +F ILG QLF G++ SRCRLTPYP+++ + Y+ WP +YL+ V S P + CL E + ++D S +T+ + SPW Q C Sbjct: 264 FVFLIFGILGIQLFGGLMTSRCRLTPYPIKMPVDKDGTYQ--WPIPSEYLAKVISDPVTYQCLNEP----LLSHEDRSSRLYTKET-SPWRFPQDC 352
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Match: A0A5D6Y6M5_9STRA (WW domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6Y6M5_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 4.380e-8 Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 1 Query: 1 FMLTVFSILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSSPEDWACLLEEGGGGAVENDDSSWTRRSDSPWFEAQVC 267 F+ ++ ++G QL+SGV+HSRCRLTPYPV L ++ + P Y V+ + C E + +D+SWT S SPW +VC Sbjct: 325 FLFFLYGVIGVQLWSGVMHSRCRLTPYPVHLDPKLTLQD--LPAYQEFVTVNHPLHRCRDENDK--IISTEDASWTHDS-SPWRVPKVC 408 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10171.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 18 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10171.1.1 >prot_D-mesarthrocarpus_Contig10171.1.1 ID=prot_D-mesarthrocarpus_Contig10171.1.1|Name=mRNA_D-mesarthrocarpus_Contig10171.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=91bp MLTVFSILGQQLFSGVLHSRCRLTPYPVRLGECSSVYEDCWPQYLSNVSSback to top mRNA from alignment at D-mesarthrocarpus_Contig10171:445..1659+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10171.1.1 ID=mRNA_D-mesarthrocarpus_Contig10171.1.1|Name=mRNA_D-mesarthrocarpus_Contig10171.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=1215bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10171:445..1659+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10171:445..1659+ >mRNA_D-mesarthrocarpus_Contig10171.1.1 ID=mRNA_D-mesarthrocarpus_Contig10171.1.1|Name=mRNA_D-mesarthrocarpus_Contig10171.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=273bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10171:445..1659+ (Discosporangium mesarthrocarpum MT17_79)back to top |