mRNA_D-mesarthrocarpus_Contig10133.2.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10133.2.1 vs. uniprot
Match: A0A6H5KKZ1_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKZ1_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 1.500e-15 Identity = 33/51 (64.71%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 4 KFHEALVLRHLRASSLPMRLWGWEQVQEIIHSSHQDRWQPKAYLVSVRGLQ 156 +FH LVLRHLRASSLPMRLWGWEQ +++I+ SH+ RW KAYLV G + Sbjct: 277 RFHSELVLRHLRASSLPMRLWGWEQTEDLINHSHRHRWHAKAYLVEGAGTK 327
BLAST of mRNA_D-mesarthrocarpus_Contig10133.2.1 vs. uniprot
Match: D7G2G5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2G5_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 6.290e-14 Identity = 30/44 (68.18%), Postives = 36/44 (81.82%), Query Frame = 1 Query: 4 KFHEALVLRHLRASSLPMRLWGWEQVQEIIHSSHQDRWQPKAYL 135 +FH LVLRHLRASSLPMRLWGWEQ +++I+ SH+ RW K YL Sbjct: 315 RFHSELVLRHLRASSLPMRLWGWEQTEDLINHSHRHRWNAKVYL 358
BLAST of mRNA_D-mesarthrocarpus_Contig10133.2.1 vs. uniprot
Match: A0A1Z5K2Z6_FISSO (Ubiquitin carboxyl-terminal hydrolase 9/24 n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K2Z6_FISSO) HSP 1 Score: 50.4 bits (119), Expect = 9.010e-6 Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 1 Query: 1 FKFHEALVLRHLRASSLPMRLWGWEQVQEIIHSSHQDRWQPKAYLVSVRG 150 + F LVLR +R+ SLP++L+GWEQV ++I + R P+ YLVS G Sbjct: 275 YAFWRDLVLRLIRSQSLPLKLFGWEQVADLIRACESHRPPPREYLVSNAG 324 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10133.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10133.2.1 >prot_D-mesarthrocarpus_Contig10133.2.1 ID=prot_D-mesarthrocarpus_Contig10133.2.1|Name=mRNA_D-mesarthrocarpus_Contig10133.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=54bp FKFHEALVLRHLRASSLPMRLWGWEQVQEIIHSSHQDRWQPKAYLVSVRGback to top mRNA from alignment at D-mesarthrocarpus_Contig10133:1637..1798- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10133.2.1 ID=mRNA_D-mesarthrocarpus_Contig10133.2.1|Name=mRNA_D-mesarthrocarpus_Contig10133.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=162bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10133:1637..1798- (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10133:1637..1798- >mRNA_D-mesarthrocarpus_Contig10133.2.1 ID=mRNA_D-mesarthrocarpus_Contig10133.2.1|Name=mRNA_D-mesarthrocarpus_Contig10133.2.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=162bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10133:1637..1798- (Discosporangium mesarthrocarpum MT17_79)back to top |