mRNA_D-mesarthrocarpus_Contig10120.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: D8LCY7_ECTSI (Long-chain-fatty-acid--CoA ligase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCY7_ECTSI) HSP 1 Score: 61.6 bits (148), Expect = 7.140e-10 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 4 KVKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESI 138 KV+AIHLEP+PFS +N +LTPTFKLKRA+A Y VI +LY + Sbjct: 606 KVRAIHLEPDPFSAQNGLLTPTFKLKRAQALEAYSKVIAALYAGL 650
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A1W0ABM4_9STRA (Long-chain-fatty-acid--CoA ligase n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0ABM4_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 9.750e-10 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYE 132 V+AIHL P FSVEN+MLTPTFKLKR +A+ + G+I SLYE Sbjct: 653 VRAIHLHPERFSVENDMLTPTFKLKRNDAKKAFIGIIDSLYE 694
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A0A7CLL0_9STRA (Secreted protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A0A7CLL0_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 9.760e-10 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYE 132 V+AIHL P FSVEN+MLTPTFKLKR +A+ + G+I SLYE Sbjct: 653 VRAIHLHPERFSVENDMLTPTFKLKRNDAKKAFIGIIDSLYE 694
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A7S0URD6_9CHLO (Hypothetical protein n=1 Tax=Polytomella parva TaxID=51329 RepID=A0A7S0URD6_9CHLO) HSP 1 Score: 60.8 bits (146), Expect = 1.330e-9 Identity = 28/45 (62.22%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 4 KVKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESI 138 +VKAIHL P PFSVEN +LTPTFKLKR +A+A + IK +Y I Sbjct: 665 QVKAIHLHPEPFSVENGLLTPTFKLKRPQAKAAFEEQIKRMYSKI 709
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A0L0HCT3_SPIPD (Long-chain-fatty-acid--CoA ligase n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HCT3_SPIPD) HSP 1 Score: 60.1 bits (144), Expect = 2.490e-9 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESI 138 VKAIHLEP +SV+NNM+TPTFKLKR EA Y +I +LYE + Sbjct: 661 VKAIHLEPEVWSVDNNMMTPTFKLKRNEAADKYRPIIDALYEEV 704
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A1V9YF94_9STRA (Long-chain-fatty-acid--CoA ligase n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YF94_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 2.490e-9 Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLY 129 ++A+HLEP PFS+ENN+LTPT KLKR +A TY G I LY Sbjct: 615 IRAVHLEPTPFSIENNLLTPTLKLKRHDATKTYAGKIDVLY 655
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A1V9YUQ7_9STRA (Long-chain-fatty-acid--CoA ligase n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YUQ7_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 4.660e-9 Identity = 25/44 (56.82%), Postives = 34/44 (77.27%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESI 138 ++A+HLEP PFS+ENN+LTPT KLKR +A TY I +LY ++ Sbjct: 652 IRAVHLEPTPFSIENNLLTPTLKLKRHDATKTYAAQIDALYVAL 695
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A8H7EQZ6_9FUNG (Long-chain-fatty-acid--CoA ligase n=1 Tax=Apophysomyces ossiformis TaxID=679940 RepID=A0A8H7EQZ6_9FUNG) HSP 1 Score: 59.3 bits (142), Expect = 4.660e-9 Identity = 27/43 (62.79%), Postives = 34/43 (79.07%), Query Frame = 1 Query: 10 KAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESI 138 +AI LEP PFS+ENN+LTPTFK+KRA+A+ Y I+ LYE I Sbjct: 621 RAIFLEPEPFSIENNLLTPTFKIKRAQAKQHYQIQIEKLYEQI 663
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: A0A4W5L5L8_9TELE (Uncharacterized protein n=1 Tax=Hucho hucho TaxID=62062 RepID=A0A4W5L5L8_9TELE) HSP 1 Score: 58.2 bits (139), Expect = 5.450e-9 Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYES 135 V+A+ LEP PFSVEN +LTPTFKLKR +A+A Y VI LY S Sbjct: 154 VRAVQLEPMPFSVENGLLTPTFKLKRHDAKALYAKVIDPLYAS 196
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Match: UPI00053B9F31 (long chain acyl-CoA synthetase 2-like n=1 Tax=Camelina sativa TaxID=90675 RepID=UPI00053B9F31) HSP 1 Score: 56.6 bits (135), Expect = 9.710e-9 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 7 VKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLY 129 +KAIHLEPNPF +E +++TPTFKLKR + Y G++ LY Sbjct: 105 LKAIHLEPNPFDIERDLITPTFKLKRPQLLQHYKGIVDQLY 145 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10120.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10120.1.1 >prot_D-mesarthrocarpus_Contig10120.1.1 ID=prot_D-mesarthrocarpus_Contig10120.1.1|Name=mRNA_D-mesarthrocarpus_Contig10120.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=46bp MKVKAIHLEPNPFSVENNMLTPTFKLKRAEAQATYYGVIKSLYESIback to top mRNA from alignment at D-mesarthrocarpus_Contig10120:442..579+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10120.1.1 ID=mRNA_D-mesarthrocarpus_Contig10120.1.1|Name=mRNA_D-mesarthrocarpus_Contig10120.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=138bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10120:442..579+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10120:442..579+ >mRNA_D-mesarthrocarpus_Contig10120.1.1 ID=mRNA_D-mesarthrocarpus_Contig10120.1.1|Name=mRNA_D-mesarthrocarpus_Contig10120.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=138bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10120:442..579+ (Discosporangium mesarthrocarpum MT17_79)back to top |