mRNA_D-mesarthrocarpus_Contig10075.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10075.1.1 vs. uniprot
Match: D7FS63_ECTSI (TGc domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS63_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 3.470e-9 Identity = 41/114 (35.96%), Postives = 60/114 (52.63%), Query Frame = 1 Query: 166 INAVDLQPRQHFVSLM-GVLDGVLLPSSPPHLMHSYMRMHTTD-----------------GFASMD--VTDRKLFNAAQAQLLREEPSEGLGMHSKGIVDWDGRSEYFSHMANE 447 + A + RQ FV+L GVL GVL P P L+HSY+ + G+ +D + D LF+AA+A+L++E +EG G+H G+ +WDG S+ F MA E Sbjct: 290 LQAQGIPARQRFVNLSNGVLRGVLSPP-PARLLHSYVEVQLDGRVDGGPPDCSELGQDSLGWIRVDGYIADPALFHAARARLVKENMTEGYGVHVNGVNEWDGASDSFCQMAEE 402
BLAST of mRNA_D-mesarthrocarpus_Contig10075.1.1 vs. uniprot
Match: A0A6H5LB97_9PHAE (TGc domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LB97_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 8.660e-8 Identity = 40/115 (34.78%), Postives = 58/115 (50.43%), Query Frame = 1 Query: 166 INAVDLQPRQHFVSLM-GVLDGVLLPSSPPHLMHSYMRMHTTD------------------GFASMD--VTDRKLFNAAQAQLLREEPSEGLGMHSKGIVDWDGRSEYFSHMANE 447 + A + RQ FV+L GVL GVL P P L+HSY+ + G+ +D + D LF+AA+A+L++E +EG G+H G +WDG + F MA E Sbjct: 80 LQAQGIPARQRFVNLSNGVLRGVLSPP-PARLLHSYVEVKLDGQVGDGDPPGSSELGQDSLGWIRVDGYIADPALFHAARARLVKENMTEGYGVHVNGANEWDGTLDSFCQMAEE 193 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10075.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10075.1.1 >prot_D-mesarthrocarpus_Contig10075.1.1 ID=prot_D-mesarthrocarpus_Contig10075.1.1|Name=mRNA_D-mesarthrocarpus_Contig10075.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=161bp SQREGSHNLQLLSRLGEVRIHRVFRRGHSRPENGSRSRAPAILSRHSLKPback to top mRNA from alignment at D-mesarthrocarpus_Contig10075:398..956+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10075.1.1 ID=mRNA_D-mesarthrocarpus_Contig10075.1.1|Name=mRNA_D-mesarthrocarpus_Contig10075.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=559bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10075:398..956+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10075:398..956+ >mRNA_D-mesarthrocarpus_Contig10075.1.1 ID=mRNA_D-mesarthrocarpus_Contig10075.1.1|Name=mRNA_D-mesarthrocarpus_Contig10075.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=483bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10075:398..956+ (Discosporangium mesarthrocarpum MT17_79)back to top |