mRNA_D-mesarthrocarpus_Contig10068.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: D7FPA2_ECTSI (DNA polymerase epsilon catalytic subunit n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPA2_ECTSI) HSP 1 Score: 93.2 bits (230), Expect = 1.260e-22 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 Y++Y EGPPRLGWIFNMLPT+ PDASG E+SGLDMYFLEQDGGTFKA V Sbjct: 33 YDRYSEGPPRLGWIFNMLPTSIPDASGNEKSGLDMYFLEQDGGTFKATV 81
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: D8LQC0_ECTSI (DNA polymerase epsilon catalytic subunit n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQC0_ECTSI) HSP 1 Score: 93.2 bits (230), Expect = 2.310e-20 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 Y++Y EGPPRLGWIFNMLPT+ PDASG E+SGLDMYFLEQDGGTFKA V Sbjct: 84 YDRYSEGPPRLGWIFNMLPTSIPDASGNEKSGLDMYFLEQDGGTFKATV 132
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: A0A812Q0Y1_9DINO (DNA polymerase epsilon catalytic subunit (Fragment) n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A812Q0Y1_9DINO) HSP 1 Score: 68.6 bits (166), Expect = 1.060e-11 Identity = 29/49 (59.18%), Postives = 38/49 (77.55%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 YE + EGPPR+G++ NMLPT+ + IERS LD+YFL+QDG TFKA + Sbjct: 58 YETFTEGPPRVGYLTNMLPTSVANEDRIERSALDLYFLQQDGATFKAQL 106
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: W7TVX1_9STRA (DNA-directed DNA polymerase n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TVX1_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 9.540e-11 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFK 198 Y ++ EG PRLGW+ +M +T PD G ERSG+D+YFL+QDG TFK Sbjct: 69 YSRFEEGSPRLGWLLDMNASTVPDEEGRERSGMDLYFLQQDGDTFK 114
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: A0A6H5JC65_9PHAE (DNA polymerase epsilon catalytic subunit n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC65_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 8.720e-10 Identity = 29/39 (74.36%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 109 MLPTTAPDASGIERSGLDMYFLEQDGGTFKAMVGRLEQR 225 MLPT+ PDASG E+SGLDMYFLEQDGGTFKA V R Sbjct: 1 MLPTSIPDASGNEKSGLDMYFLEQDGGTFKATVRTCRDR 39
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: A0A4P9YWH3_9FUNG (DNA polymerase epsilon catalytic subunit (Fragment) n=1 Tax=Syncephalis pseudoplumigaleata TaxID=1712513 RepID=A0A4P9YWH3_9FUNG) HSP 1 Score: 58.9 bits (141), Expect = 2.570e-8 Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIE-RSGLDMYFLEQDGGTFKAMV 207 + ++ EGPPRLGW+ NM PT D R+G+D YFLE+DG TFKA + Sbjct: 74 FHRFQEGPPRLGWLINMHPTLVHDKDTPSGRAGVDYYFLEEDGNTFKATI 123
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: UPI0007121309 (DNA polymerase n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007121309) HSP 1 Score: 58.9 bits (141), Expect = 2.600e-8 Identity = 24/49 (48.98%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 YE Y EGP RLGW+ N++ TT +RSGL+ +F+EQ+G FKA + Sbjct: 382 YETYTEGPKRLGWLLNLVNTTVTKEGSPDRSGLECFFIEQNGNLFKATI 430
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: A0A5A8DJC1_CAFRO (DNA polymerase epsilon catalytic subunit n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8DJC1_CAFRO) HSP 1 Score: 57.8 bits (138), Expect = 6.680e-8 Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 Y+ EG ++G++ NML +T IERSG+D+YFL+QDGGTFKA V Sbjct: 14 YDHLQEGEEQVGYLVNMLASTVAGDDRIERSGIDLYFLKQDGGTFKATV 62
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: A0A1S8W0Z6_9FUNG (DNA polymerase epsilon catalytic subunit (Fragment) n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8W0Z6_9FUNG) HSP 1 Score: 56.6 bits (135), Expect = 1.650e-7 Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTT-APDASGIERSGLDMYFLEQDGGTFKAMV 207 + +Y EGP +LGW+ N+ PTT D ++GLDMYF+E+DG TFKA + Sbjct: 94 FARYREGPEKLGWLVNIQPTTIVDDECPTGKAGLDMYFIEEDGTTFKATL 143
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Match: D8M3N9_BLAHO (DNA polymerase epsilon catalytic subunit n=1 Tax=Blastocystis hominis TaxID=12968 RepID=D8M3N9_BLAHO) HSP 1 Score: 56.2 bits (134), Expect = 2.350e-7 Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 61 YEKYIEGPPRLGWIFNMLPTTAPDASGIERSGLDMYFLEQDGGTFKAMV 207 YE + GP RLGW+ N++ TT P ++SGLD +F+EQ+G FK+ + Sbjct: 210 YETFSSGPKRLGWLLNLVNTTVPKIGSPDQSGLDCFFIEQNGNLFKSTL 258 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10068.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10068.1.1 >prot_D-mesarthrocarpus_Contig10068.1.1 ID=prot_D-mesarthrocarpus_Contig10068.1.1|Name=mRNA_D-mesarthrocarpus_Contig10068.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=78bp MLALPLPLPLTLPLPLPSSYEKYIEGPPRLGWIFNMLPTTAPDASGIERSback to top mRNA from alignment at D-mesarthrocarpus_Contig10068:4178..4414+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10068.1.1 ID=mRNA_D-mesarthrocarpus_Contig10068.1.1|Name=mRNA_D-mesarthrocarpus_Contig10068.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=237bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10068:4178..4414+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10068:4178..4414+ >mRNA_D-mesarthrocarpus_Contig10068.1.1 ID=mRNA_D-mesarthrocarpus_Contig10068.1.1|Name=mRNA_D-mesarthrocarpus_Contig10068.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=234bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10068:4178..4414+ (Discosporangium mesarthrocarpum MT17_79)back to top |