mRNA_D-mesarthrocarpus_Contig10046.3.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10046.3.1 vs. uniprot
Match: A0A6H5KJV9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJV9_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 4.570e-15 Identity = 38/66 (57.58%), Postives = 47/66 (71.21%), Query Frame = 1 Query: 19 VSHVCDSLKRVFETHGACPIAPPALRPKPPXXXXXXXATATRPVSLLNSSGAVVTLPGDLTSSFAR 216 V+ VCD L+RVFETHGA P+APP +RPKPP + + V L++ GAVVTLPG+LTS FAR Sbjct: 96 VALVCDGLRRVFETHGATPVAPPTIRPKPPPSLAPPVSASRGLVRLVDRKGAVVTLPGNLTSPFAR 161
BLAST of mRNA_D-mesarthrocarpus_Contig10046.3.1 vs. uniprot
Match: D7G2X9_ECTSI (Non-specific serine/threonine protein kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2X9_ECTSI) HSP 1 Score: 74.7 bits (182), Expect = 5.650e-14 Identity = 37/66 (56.06%), Postives = 45/66 (68.18%), Query Frame = 1 Query: 19 VSHVCDSLKRVFETHGACPIAPPALRPKPPXXXXXXXATATRPVSLLNSSGAVVTLPGDLTSSFAR 216 V+ VCD L+RVFETHGA P+APP +RPKPP + V L++ GAVVTLPG+LT FAR Sbjct: 946 VALVCDGLRRVFETHGATPVAPPTIRPKPPPSLAPPALASRGLVRLVDRKGAVVTLPGNLTVPFAR 1011
BLAST of mRNA_D-mesarthrocarpus_Contig10046.3.1 vs. uniprot
Match: A0A835YR31_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR31_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 1.100e-8 Identity = 31/63 (49.21%), Postives = 39/63 (61.90%), Query Frame = 1 Query: 28 VCDSLKRVFETHGACPIAPPALRPKPPXXXXXXXATATRPVSLLNSSGAVVTLPGDLTSSFAR 216 VCD L+ FE HGA P+APP L P+PP + +P++LL+S G VV L DLT FAR Sbjct: 1003 VCDVLRHAFEAHGAIPLAPPLLSPRPPRGEGGAYSVR-QPMTLLDSRGTVVVLARDLTVPFAR 1064
BLAST of mRNA_D-mesarthrocarpus_Contig10046.3.1 vs. uniprot
Match: A0A1Z5KBK1_FISSO (Non-specific serine/threonine protein kinase n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5KBK1_FISSO) HSP 1 Score: 58.5 bits (140), Expect = 2.810e-8 Identity = 33/72 (45.83%), Postives = 41/72 (56.94%), Query Frame = 1 Query: 1 GMDPSMVSHVCDSLKRVFETHGACPIAPPALRPKPPXXXXXXXATATRPVSLLNSSGAVVTLPGDLTSSFAR 216 G DP +V VC+ LK VF HGA + P LRP+ + P +LNS GAV++LP DLT SFAR Sbjct: 937 GSDPFVVETVCEKLKAVFHMHGASRLQNPLLRPR--ANHSSGINSTGGPAEVLNSRGAVLSLPEDLTVSFAR 1006 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10046.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10046.3.1 >prot_D-mesarthrocarpus_Contig10046.3.1 ID=prot_D-mesarthrocarpus_Contig10046.3.1|Name=mRNA_D-mesarthrocarpus_Contig10046.3.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=72bp MDPSMVSHVCDSLKRVFETHGACPIAPPALRPKPPPSMAPAPATATRPVSback to top mRNA from alignment at D-mesarthrocarpus_Contig10046:3575..3793+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10046.3.1 ID=mRNA_D-mesarthrocarpus_Contig10046.3.1|Name=mRNA_D-mesarthrocarpus_Contig10046.3.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=219bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10046:3575..3793+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10046:3575..3793+ >mRNA_D-mesarthrocarpus_Contig10046.3.1 ID=mRNA_D-mesarthrocarpus_Contig10046.3.1|Name=mRNA_D-mesarthrocarpus_Contig10046.3.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=216bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10046:3575..3793+ (Discosporangium mesarthrocarpum MT17_79)back to top |