mRNA_D-mesarthrocarpus_Contig10045.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: D5BZY6_NITHN (Beta-phosphoglucomutase family hydrolase n=1 Tax=Nitrosococcus halophilus (strain Nc4) TaxID=472759 RepID=D5BZY6_NITHN) HSP 1 Score: 48.9 bits (115), Expect = 1.250e-5 Identity = 19/34 (55.88%), Postives = 26/34 (76.47%), Query Frame = 1 Query: 1 HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQL 102 HP + +VYELQPD+ WDKG+A++WLLD+L Sbjct: 413 HPGLHKSHGKKVYELQPDVAWDKGRALLWLLDKL 446
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: D7G992_ECTSI (Trehalose-6-phosphate phosphatase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G992_ECTSI) HSP 1 Score: 48.5 bits (114), Expect = 1.730e-5 Identity = 19/25 (76.00%), Postives = 23/25 (92.00%), Query Frame = 1 Query: 28 SQVYELQPDIKWDKGKAVMWLLDQL 102 +V+ELQPDI WDKGKAV+WLLD+L Sbjct: 222 KEVFELQPDIAWDKGKAVLWLLDKL 246
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A2V5LEJ0_9BACT (Trehalose-phosphatase (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5LEJ0_9BACT) HSP 1 Score: 45.4 bits (106), Expect = 4.430e-5 Identity = 18/25 (72.00%), Postives = 22/25 (88.00%), Query Frame = 1 Query: 28 SQVYELQPDIKWDKGKAVMWLLDQL 102 +VYEL PDI+WDKGKAV+WLL+ L Sbjct: 4 KKVYELLPDIEWDKGKAVLWLLEAL 28
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A2V5KVT7_9BACT (Trehalose 6-phosphate phosphatase n=3 Tax=unclassified Verrucomicrobia TaxID=417295 RepID=A0A2V5KVT7_9BACT) HSP 1 Score: 47.0 bits (110), Expect = 5.750e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 1 HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQL 102 HP + + +VYEL PDI WDKGKAV+WL++ L Sbjct: 158 HPELRRIKGKKVYELLPDIDWDKGKAVVWLMESL 191
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A2V5S642_9BACT (Trehalose 6-phosphate phosphatase n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5S642_9BACT) HSP 1 Score: 47.0 bits (110), Expect = 5.810e-5 Identity = 19/34 (55.88%), Postives = 26/34 (76.47%), Query Frame = 1 Query: 1 HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQL 102 HP + L +VYELQPDI W+KGKA++WLL+ + Sbjct: 163 HPQLRLLVGKKVYELQPDIDWNKGKALLWLLEMI 196
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A651H8M9_9BACT (Trehalose-phosphatase n=1 Tax=Gemmatimonadales bacterium TaxID=2448054 RepID=A0A651H8M9_9BACT) HSP 1 Score: 47.0 bits (110), Expect = 5.990e-5 Identity = 16/25 (64.00%), Postives = 24/25 (96.00%), Query Frame = 1 Query: 28 SQVYELQPDIKWDKGKAVMWLLDQL 102 +++ELQPD++WDKG+AV+WLL+QL Sbjct: 432 KKIFELQPDVEWDKGRAVLWLLEQL 456
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A7C7RFT3_9BACT (Trehalose-phosphatase (Fragment) n=1 Tax=Candidatus Latescibacteria bacterium TaxID=2053570 RepID=A0A7C7RFT3_9BACT) HSP 1 Score: 47.0 bits (110), Expect = 6.010e-5 Identity = 18/25 (72.00%), Postives = 22/25 (88.00%), Query Frame = 1 Query: 28 SQVYELQPDIKWDKGKAVMWLLDQL 102 +VYEL+PDIKWDKG+A+ WLLD L Sbjct: 424 KKVYELRPDIKWDKGEAIFWLLDTL 448
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A1WTX7_HALHL (Trehalose 6-phosphate phosphatase n=1 Tax=Halorhodospira halophila (strain DSM 244 / SL1) TaxID=349124 RepID=A1WTX7_HALHL) HSP 1 Score: 46.6 bits (109), Expect = 7.980e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 1 HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQL 102 HP + P V+ELQPD+ WDKG+AV+WLL+ L Sbjct: 166 HPGLRCGPGKCVFELQPDVAWDKGRAVLWLLEAL 199
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: A0A2V6D1R2_9BACT (Trehalose 6-phosphate phosphatase n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6D1R2_9BACT) HSP 1 Score: 46.6 bits (109), Expect = 8.200e-5 Identity = 18/34 (52.94%), Postives = 27/34 (79.41%), Query Frame = 1 Query: 1 HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQL 102 +P + + +VYELQPD+ W+KGKAV+WLL++L Sbjct: 180 YPKLRKIDNKKVYELQPDVDWNKGKAVIWLLERL 213
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Match: UPI0003015B7F (trehalose-phosphatase n=1 Tax=Nitrosococcus watsonii TaxID=473531 RepID=UPI0003015B7F) HSP 1 Score: 46.6 bits (109), Expect = 8.260e-5 Identity = 17/25 (68.00%), Postives = 23/25 (92.00%), Query Frame = 1 Query: 28 SQVYELQPDIKWDKGKAVMWLLDQL 102 +VYELQPD+ WDKG+A++WLLD+L Sbjct: 226 KKVYELQPDVAWDKGQALLWLLDKL 250 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10045.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 10 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10045.1.1 >prot_D-mesarthrocarpus_Contig10045.1.1 ID=prot_D-mesarthrocarpus_Contig10045.1.1|Name=mRNA_D-mesarthrocarpus_Contig10045.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=34bp HPAVPPLPCSQVYELQPDIKWDKGKAVMWLLDQLback to top mRNA from alignment at D-mesarthrocarpus_Contig10045:591..692+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10045.1.1 ID=mRNA_D-mesarthrocarpus_Contig10045.1.1|Name=mRNA_D-mesarthrocarpus_Contig10045.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=102bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10045:591..692+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10045:591..692+ >mRNA_D-mesarthrocarpus_Contig10045.1.1 ID=mRNA_D-mesarthrocarpus_Contig10045.1.1|Name=mRNA_D-mesarthrocarpus_Contig10045.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=102bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10045:591..692+ (Discosporangium mesarthrocarpum MT17_79)back to top |