mRNA_D-mesarthrocarpus_Contig10044.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10044.1.1 vs. uniprot
Match: A0A6H5JIJ8_9PHAE (Vacuolar protein sorting-associated protein 51 homolog (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIJ8_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 7.150e-9 Identity = 32/57 (56.14%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 4 ADSVVGHARLLSRLDSSPRVLANQLRLAVWGVTLWLASSLSSMAGVTVDASVVQQLP 174 AD +V R LSRLDSSP LA +LR +WGV LWLAS+L +AGVT +S LP Sbjct: 662 ADEIVSGLRPLSRLDSSPGPLAEELRFGLWGVVLWLASALGIVAGVTGGSSSCDSLP 718
BLAST of mRNA_D-mesarthrocarpus_Contig10044.1.1 vs. uniprot
Match: D8LRL8_ECTSI (Vacuolar protein sorting-associated protein 51 homolog n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRL8_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 9.880e-9 Identity = 32/57 (56.14%), Postives = 37/57 (64.91%), Query Frame = 1 Query: 4 ADSVVGHARLLSRLDSSPRVLANQLRLAVWGVTLWLASSLSSMAGVTVDASVVQQLP 174 AD +V R LSRLDSSP LA +LR +WGV LWLAS+ +AGVT AS LP Sbjct: 569 ADEIVSGLRPLSRLDSSPGPLAEELRFGLWGVVLWLASAFGIVAGVTGGASSCDSLP 625 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10044.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10044.1.1 >prot_D-mesarthrocarpus_Contig10044.1.1 ID=prot_D-mesarthrocarpus_Contig10044.1.1|Name=mRNA_D-mesarthrocarpus_Contig10044.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=130bp EADSVVGHARLLSRLDSSPRVLANQLRLAVWGVTLWLASSLSSMAGVTVDback to top mRNA from alignment at D-mesarthrocarpus_Contig10044:43..1312+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10044.1.1 ID=mRNA_D-mesarthrocarpus_Contig10044.1.1|Name=mRNA_D-mesarthrocarpus_Contig10044.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=1270bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10044:43..1312+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10044:43..1312+ >mRNA_D-mesarthrocarpus_Contig10044.1.1 ID=mRNA_D-mesarthrocarpus_Contig10044.1.1|Name=mRNA_D-mesarthrocarpus_Contig10044.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=390bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10044:43..1312+ (Discosporangium mesarthrocarpum MT17_79)back to top |