mRNA_D-mesarthrocarpus_Contig10042.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10042.1.1 vs. uniprot
Match: A0A6H5KT96_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT96_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 2.200e-10 Identity = 30/60 (50.00%), Postives = 44/60 (73.33%), Query Frame = 1 Query: 7 VLDILSQLNERDAKDVGSRAKHCRQFVADNVMAQVAAGLLEAAEVQPSDTLDFLANYLIR 186 + ++L++L RDAK+V +R + R F+ + V+ QVAAGL+ AAE QP + +FLANYLIR Sbjct: 723 LSEVLAKLTARDAKEVETRTRRHRNFLTEGVVPQVAAGLVAAAEAQPENVFEFLANYLIR 782
BLAST of mRNA_D-mesarthrocarpus_Contig10042.1.1 vs. uniprot
Match: D7FXW4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXW4_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 4.110e-10 Identity = 30/60 (50.00%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 7 VLDILSQLNERDAKDVGSRAKHCRQFVADNVMAQVAAGLLEAAEVQPSDTLDFLANYLIR 186 + ++L++L RDAK+V R + R F+ + V+ QVAAGL+ AAE QP + +FLANYLIR Sbjct: 672 LSEVLAKLTARDAKEVEMRTRRHRNFLTEGVVPQVAAGLVAAAEAQPENVFEFLANYLIR 731 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10042.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10042.1.1 >prot_D-mesarthrocarpus_Contig10042.1.1 ID=prot_D-mesarthrocarpus_Contig10042.1.1|Name=mRNA_D-mesarthrocarpus_Contig10042.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=62bp DEVLDILSQLNERDAKDVGSRAKHCRQFVADNVMAQVAAGLLEAAEVQPSback to top mRNA from alignment at D-mesarthrocarpus_Contig10042:659..844+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10042.1.1 ID=mRNA_D-mesarthrocarpus_Contig10042.1.1|Name=mRNA_D-mesarthrocarpus_Contig10042.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=186bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10042:659..844+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10042:659..844+ >mRNA_D-mesarthrocarpus_Contig10042.1.1 ID=mRNA_D-mesarthrocarpus_Contig10042.1.1|Name=mRNA_D-mesarthrocarpus_Contig10042.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=186bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10042:659..844+ (Discosporangium mesarthrocarpum MT17_79)back to top |