prot_D-dichotoma_M_contig959.20297.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig959.20297.1 vs. uniprot
Match: D7G8S2_ECTSI (Molecular chaperone, heat shock protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8S2_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 1.480e-8 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 1 MFRCPVCDAVGRVGTTLGFGGTLCSLCQGRCYLNREP 37 M RCPVC+ G+ GTTLGFGGT C+LC G+C+L EP Sbjct: 1 MTRCPVCEGSGKTGTTLGFGGTTCALCHGKCFLRTEP 37 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig959.20297.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig959.20297.1 ID=prot_D-dichotoma_M_contig959.20297.1|Name=mRNA_D-dichotoma_M_contig959.20297.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=166bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|