prot_D-dichotoma_M_contig958.20287.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig958.20287.1 vs. uniprot
Match: A0A7S1FYW6_9STRA (Hypothetical protein n=1 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1FYW6_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 9.200e-8 Identity = 35/95 (36.84%), Postives = 53/95 (55.79%), Query Frame = 0 Query: 122 LGFHRAEGKRGYTVTEERKARILEFLIDFTEAYELDRDETSSCKIVYMDESYLHINHKSKFSWFTVDGDHRSSNSNGDGQRIIIVHAINADGPVI 216 L + RA K ++ ER I +L F+EA + ++ C VYMDESY+H H + + ++ + RS S G+R+IIVHAI DGP++ Sbjct: 6 LSYKRARLK-ARILSNERIKYICSYLCHFSEALDFEKKGGRIC--VYMDESYIHTTHSTSYGYYFKE--QRSGQSASKGRRLIIVHAICKDGPLV 95 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig958.20287.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig958.20287.1 ID=prot_D-dichotoma_M_contig958.20287.1|Name=mRNA_D-dichotoma_M_contig958.20287.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=335bpback to top |