prot_D-dichotoma_M_contig954.20253.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig954.20253.1 vs. uniprot
Match: A0A6H5K857_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K857_9PHAE) HSP 1 Score: 78.6 bits (192), Expect = 2.300e-15 Identity = 33/48 (68.75%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 1 DLSTDLYDLAPAVVTWIRDFTPPELEWKWTPEEVSHLPAAFFEFNCSG 48 D T+LYDLAPA V W+RD TPP++EW WTPEEVSHL A FEF C G Sbjct: 1111 DSETELYDLAPAEVVWVRDATPPQVEWLWTPEEVSHLSNALFEFTCLG 1158
BLAST of mRNA_D-dichotoma_M_contig954.20253.1 vs. uniprot
Match: D8LBK9_ECTSI (OmpA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBK9_ECTSI) HSP 1 Score: 77.4 bits (189), Expect = 5.870e-15 Identity = 32/48 (66.67%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 1 DLSTDLYDLAPAVVTWIRDFTPPELEWKWTPEEVSHLPAAFFEFNCSG 48 D T+LYDL+PA V W+RD TPP+L+W WTPEEVSHL A FEF C G Sbjct: 1305 DSETELYDLSPAEVVWVRDATPPQLDWLWTPEEVSHLSNALFEFTCLG 1352 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig954.20253.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig954.20253.1 ID=prot_D-dichotoma_M_contig954.20253.1|Name=mRNA_D-dichotoma_M_contig954.20253.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=71bpback to top |