prot_D-dichotoma_M_contig952.20244.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig952.20244.1 vs. uniprot
Match: A0A6H5JC20_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC20_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 6.960e-9 Identity = 46/105 (43.81%), Postives = 59/105 (56.19%), Query Frame = 0 Query: 1 MQELAESVVDLGQSSSLKCDW--KLDLYHQDGAMPAEPGANGAASQAAGTGAETT--GEGAVRGVTPASSTV-----PLFNVEEGEFVALPTPPGMKESVSVGKV 96 M+ELAESVV+L +S+ + W + D+Y D PA NG+ +G T+ G G+V G S P+F+VE GEFVALPTPPG SV VGKV Sbjct: 1 MEELAESVVELSRSTPVPFGWGSECDMYTLDNQEPASD-CNGSQQTPSGAAGATSPAGAGSVSGRGTGSRARKRVDGPVFHVEVGEFVALPTPPGTA-SVLVGKV 103 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig952.20244.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig952.20244.1 ID=prot_D-dichotoma_M_contig952.20244.1|Name=mRNA_D-dichotoma_M_contig952.20244.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=111bpback to top |