prot_D-dichotoma_M_contig952.20243.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig952.20243.1 vs. uniprot
Match: A0A6H5JV12_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV12_9PHAE) HSP 1 Score: 121 bits (303), Expect = 4.850e-33 Identity = 52/74 (70.27%), Postives = 61/74 (82.43%), Query Frame = 0 Query: 4 VRTPQAFKFAQDPADGEVKMQVQARSYNEDWGVINRNGEYGPGWMTLMKSWPDLRDIPDHPRKVIPDHTLHQHR 77 V PQAFK ++DP+DG MQVQ RSY E+WGVINR GEYGPG++T+MKSWPD+RD P HPRK +PD TLHQHR Sbjct: 42 VTKPQAFKVSKDPSDGVATMQVQQRSYKEEWGVINRQGEYGPGYITVMKSWPDVRDTPSHPRKSLPDATLHQHR 115 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig952.20243.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig952.20243.1 ID=prot_D-dichotoma_M_contig952.20243.1|Name=mRNA_D-dichotoma_M_contig952.20243.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=78bpback to top |