prot_D-dichotoma_M_contig95.20222.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig95.20222.1 vs. uniprot
Match: D7G7E6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7E6_ECTSI) HSP 1 Score: 109 bits (272), Expect = 7.320e-24 Identity = 54/87 (62.07%), Postives = 65/87 (74.71%), Query Frame = 0 Query: 12 GAKGEERMKMPGGLEPWQVAFVLEVADGEVLRVWSKTLISSVATYDGKHEPKGDVEKAWQLQSRLLSTVARVVSTAPVAVRELFDLG 98 G G + + GGLE WQVAFVLEVADG VL WSKTL SVA + P+G++E W +QSRLLS++ARVVSTAPVAV++LFDLG Sbjct: 424 GEDGARSVVLAGGLEAWQVAFVLEVADGAVLSAWSKTLGDSVAALESADAPEGELEPGWLMQSRLLSSIARVVSTAPVAVQQLFDLG 510 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig95.20222.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig95.20222.1 ID=prot_D-dichotoma_M_contig95.20222.1|Name=mRNA_D-dichotoma_M_contig95.20222.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=238bpback to top |