prot_D-dichotoma_M_contig946.20178.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Match: A0A6H5JJA1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJA1_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 1.950e-7 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 1 ERRPWETYIEPMLEDNTFKGRFRMGYGDFNVLVRLLRVKL 40 ERRP+ETYI+PML+D+TF RFRM Y DF VLV LR L Sbjct: 53 ERRPFETYIKPMLQDHTFSMRFRMEYDDFRVLVDHLRPAL 92
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Match: A0A6H5K540_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K540_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 6.650e-7 Identity = 26/39 (66.67%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 2 RRPWETYIEPMLEDNTFKGRFRMGYGDFNVLVRLLRVKL 40 RRP+ETYI+PML+D+TF RFRM Y DF VLV LR L Sbjct: 54 RRPFETYIKPMLQDHTFSMRFRMEYDDFRVLVDHLRPAL 92
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Match: A0A6H5K6M2_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6M2_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 9.410e-7 Identity = 25/42 (59.52%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 1 ERRPWETYIEPMLEDNTFKGRFRMGYGDFNVLVRLLRVKLVR 42 ERR + TY+ PM+EDNTF+ RFRM Y DF L +LR KL R Sbjct: 53 ERRSFYTYVRPMVEDNTFRKRFRMDYTDFMTLADILRPKLQR 94
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Match: A0A6H5JUZ7_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUZ7_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 3.250e-6 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 1 ERRPWETYIEPMLEDNTFKGRFRMGYGDFNV 31 ERRP+ETYI+PML+D+TF RFRM Y DF V Sbjct: 53 ERRPFETYIKPMLQDHTFSMRFRMEYDDFRV 83
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Match: A0A6H5K3F2_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3F2_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 8.420e-6 Identity = 23/42 (54.76%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 1 ERRPWETYIEPMLEDNTFKGRFRMGYGDFNVLVRLLRVKLVR 42 ERR W TY +PM++D TF+ RFRM Y +F +L +LR KL R Sbjct: 49 ERRSWYTYAKPMVQDGTFRLRFRMDYTEFALLADMLRPKLER 90 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig946.20178.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig946.20178.1 ID=prot_D-dichotoma_M_contig946.20178.1|Name=mRNA_D-dichotoma_M_contig946.20178.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=68bpback to top |