prot_D-dichotoma_M_contig945.20172.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig945.20172.1 vs. uniprot
Match: D8LQL1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQL1_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 2.430e-12 Identity = 40/72 (55.56%), Postives = 47/72 (65.28%), Query Frame = 0 Query: 130 VSSFPINRLEQAITHLAGAVGV-GTEPLIYVRRSDVAEVVDSLLCQARKPGGPEFNSPALERLAIVRRSAGK 200 SS N E+A+T LAGA GTEPLIYVRR+DVA +VD+L+ R P GP SPA RL +VRRS K Sbjct: 45 ASSAQGNPFEEALTRLAGAASTCGTEPLIYVRRADVAAIVDALMDVVRTPAGPTVTSPAFARLNLVRRSGRK 116
BLAST of mRNA_D-dichotoma_M_contig945.20172.1 vs. uniprot
Match: A0A6H5KYI0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYI0_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.010e-11 Identity = 40/72 (55.56%), Postives = 47/72 (65.28%), Query Frame = 0 Query: 130 VSSFPINRLEQAITHLAGAVGV-GTEPLIYVRRSDVAEVVDSLLCQARKPGGPEFNSPALERLAIVRRSAGK 200 SS N E+A+T LAGA GTEPLIYVRR+DVA +VD+L+ R P GP SPA RL +VRRS K Sbjct: 131 ASSARGNPFEEALTRLAGAASTCGTEPLIYVRRADVAVIVDALMDVVRTPAGPTVTSPAFARLNLVRRSGRK 202 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig945.20172.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig945.20172.1 ID=prot_D-dichotoma_M_contig945.20172.1|Name=mRNA_D-dichotoma_M_contig945.20172.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=304bpback to top |