mRNA_D-dichotoma_M_contig990.20539.1 (mRNA) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig990.20539.1 vs. uniprot
Match: A0A6H5JV12_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV12_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 6.910e-7 Identity = 24/36 (66.67%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 7 VRTPQAFKFAQDPADGEVKMQVQARSYNEDWGVINR 114 V PQAFK ++DP+DG MQVQ RSY E+WGVINR Sbjct: 42 VTKPQAFKVSKDPSDGVATMQVQQRSYKEEWGVINR 77 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig990.20539.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dichotoma_M_contig990.20539.1 >prot_D-dichotoma_M_contig990.20539.1 ID=prot_D-dichotoma_M_contig990.20539.1|Name=mRNA_D-dichotoma_M_contig990.20539.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=50bp MQVQARSYNEDWGVINRVYCLRVQQQRASTRVGCRSWRRVSWTSASLRA*back to top mRNA from alignment at D-dichotoma_M_contig990:247268..248037+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dichotoma_M_contig990.20539.1 ID=mRNA_D-dichotoma_M_contig990.20539.1|Name=mRNA_D-dichotoma_M_contig990.20539.1|organism=Dictyota dichotoma ODC1387m male|type=mRNA|length=770bp|location=Sequence derived from alignment at D-dichotoma_M_contig990:247268..248037+ (Dictyota dichotoma ODC1387m male)back to top Coding sequence (CDS) from alignment at D-dichotoma_M_contig990:247268..248037+ >mRNA_D-dichotoma_M_contig990.20539.1 ID=mRNA_D-dichotoma_M_contig990.20539.1|Name=mRNA_D-dichotoma_M_contig990.20539.1|organism=Dictyota dichotoma ODC1387m male|type=CDS|length=300bp|location=Sequence derived from alignment at D-dichotoma_M_contig990:247268..248037+ (Dictyota dichotoma ODC1387m male)back to top |