mRNA_D-dichotoma_M_contig1016.223.1 (mRNA) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: A0A0A1WFC7_ZEUCU (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Zeugodacus cucurbitae TaxID=28588 RepID=A0A0A1WFC7_ZEUCU) HSP 1 Score: 72.0 bits (175), Expect = 7.220e-13 Identity = 32/80 (40.00%), Postives = 51/80 (63.75%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLI 240 ++ QP FQ+ D V +L +SLYGL S + WN +++ L+EMG++A SEPC+Y + QG + ++ +YVDD +I Sbjct: 808 YMRQPEMFQQ-----DNDCVLKLKKSLYGLKQSGRVWNSRLDEVLKEMGFSACNSEPCLYTKNQGRKLNIIAVYVDDLMI 882
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: A0A6H5JVC8_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVC8_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 1.460e-12 Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLI 240 ++ Q G++ T + T P V +L +SLYGL S + + + ++E+G+ A S+PC+Y G G YA+L +YVDDC + Sbjct: 118 YVRQAKGYEITDEVTGLPLVMKLKKSLYGLKQSPRNFGNAFAKGIKEIGFTALLSDPCVYVYGAGPTYAILCVYVDDCTL 197
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: A0A6H5KY84_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY84_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 4.700e-12 Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLI 240 ++ Q G++ T + T P V +L +SLYGL S + + + ++E+G+ A S+PC+Y G G YA+L +YVDDC + Sbjct: 1014 YVRQAKGYEITDEVTGLPLVMKLKKSLYGLKQSPRNFGNAFAKGIKEIGFTALLSDPCVYVYGAGPTYAILCVYVDDCTL 1093
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: UPI000901B00D (uncharacterized protein LOC109158510 n=1 Tax=Ipomoea nil TaxID=35883 RepID=UPI000901B00D) HSP 1 Score: 68.9 bits (167), Expect = 7.690e-12 Identity = 34/78 (43.59%), Postives = 52/78 (66.67%), Query Frame = 1 Query: 13 PPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLITS 246 PPGFQ T K+ V RL RSLYGL +++ WN ++ AL G+ + S+P ++ +GQG Q+ ++++YVDD L+TS Sbjct: 4 PPGFQ-TKKQGQ---VCRLLRSLYGLKQASRQWNSRLSNALMSKGFEQSKSDPSLFIKGQGMQFIVILVYVDDILVTS 77
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: O61636_9DIPT (Reverse transcriptase (Fragment) n=3 Tax=Cellia TaxID=44534 RepID=O61636_9DIPT) HSP 1 Score: 63.5 bits (153), Expect = 1.410e-11 Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLV 216 F+ QP GF+E +K V RL RSLYGL +++AWN + + +G+ + S+PC+Y +G G Y +LV Sbjct: 9 FMTQPEGFEE-----NKNLVCRLKRSLYGLKQASRAWNTRFHVFVERLGFTRSLSDPCLYVKGSGSSYVILV 75
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: A0A409X4K8_9AGAR (Integrase catalytic domain-containing protein (Fragment) n=2 Tax=Gymnopilus dilepis TaxID=231916 RepID=A0A409X4K8_9AGAR) HSP 1 Score: 68.2 bits (165), Expect = 1.620e-11 Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLIT 243 +LEQP G+ +K K YV+RL +SLYGL A+ W + +AL E+G+ ++ ++ + +GE +LV++VDDCL+T Sbjct: 506 YLEQPKGY---AKADPKVYVFRLEKSLYGLKQGARNWYAALRKALEELGFKRMEADHGVFVKNEGECLLILVVHVDDCLLT 583
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: Q2Z1I8_MUSAC (Reverse transcriptase (Fragment) n=2 Tax=Musa acuminata TaxID=4641 RepID=Q2Z1I8_MUSAC) HSP 1 Score: 63.5 bits (153), Expect = 2.060e-11 Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCL 237 ++EQP GF+ K+ +V +L +SLYGL + + W + + E G+ TAS+ C+Y + GE + +L+LYVDD L Sbjct: 13 YMEQPEGFKVKGKDN---FVCKLKKSLYGLKQAPRQWYRKFDSFMTENGYKRTASDHCVYIKWFGEDFIILLLYVDDML 88
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: UPI001A452E0F (uncharacterized protein n=3 Tax=Ustilago hordei TaxID=120017 RepID=UPI001A452E0F) HSP 1 Score: 66.2 bits (160), Expect = 7.340e-11 Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 1 Query: 58 VWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLI 240 V+++ + LYGL S + WN N++LR MG+ PCIY +GQGE A++V+YVDD L+ Sbjct: 27 VYKVVKGLYGLKQSGREWNQEFNRSLRCMGFFQVECAPCIYTKGQGEDMAIVVIYVDDTLV 87
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: UPI0008706EB1 (uncharacterized protein LOC108866135 n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI0008706EB1) HSP 1 Score: 65.5 bits (158), Expect = 7.430e-11 Identity = 31/81 (38.27%), Postives = 49/81 (60.49%), Query Frame = 1 Query: 4 LEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLITS 246 ++QP GF + S T YVW+L +SL GL + +AWN L +G+ A+AS+ ++ + G +L+LYVDD ++TS Sbjct: 1 MKQPQGFVDVSHLT---YVWKLVKSLCGLKQAPRAWNSKFTAYLGALGFCASASDTSLFVKQDGSDIIILLLYVDDIIVTS 78
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Match: A0A067T6Q3_GALM3 (Uncharacterized protein (Fragment) n=1 Tax=Galerina marginata (strain CBS 339.88) TaxID=685588 RepID=A0A067T6Q3_GALM3) HSP 1 Score: 66.2 bits (160), Expect = 7.810e-11 Identity = 30/82 (36.59%), Postives = 51/82 (62.20%), Query Frame = 1 Query: 1 FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWAATASEPCIYQRGQGEQYALLVLYVDDCLITS 246 +++QPPG+++ + P V L RSLYGL + WN +N+AL E+G+ ++ C Y R G++Y +L+++VDD + S Sbjct: 987 YMQQPPGYEDGT-----PRVCILIRSLYGLKQAGNIWNRELNRALAEIGFTQLKTDYCCYIRRNGDEYTILLIWVDDFISAS 1063 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig1016.223.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dichotoma_M_contig1016.223.1 >prot_D-dichotoma_M_contig1016.223.1 ID=prot_D-dichotoma_M_contig1016.223.1|Name=mRNA_D-dichotoma_M_contig1016.223.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=82bp FLEQPPGFQETSKETDKPYVWRLARSLYGLATSAKAWNPTVNQALREMGWback to top mRNA from alignment at D-dichotoma_M_contig1016:7898..8143+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dichotoma_M_contig1016.223.1 ID=mRNA_D-dichotoma_M_contig1016.223.1|Name=mRNA_D-dichotoma_M_contig1016.223.1|organism=Dictyota dichotoma ODC1387m male|type=mRNA|length=246bp|location=Sequence derived from alignment at D-dichotoma_M_contig1016:7898..8143+ (Dictyota dichotoma ODC1387m male)back to top Coding sequence (CDS) from alignment at D-dichotoma_M_contig1016:7898..8143+ >mRNA_D-dichotoma_M_contig1016.223.1 ID=mRNA_D-dichotoma_M_contig1016.223.1|Name=mRNA_D-dichotoma_M_contig1016.223.1|organism=Dictyota dichotoma ODC1387m male|type=CDS|length=492bp|location=Sequence derived from alignment at D-dichotoma_M_contig1016:7898..8143+ (Dictyota dichotoma ODC1387m male)back to top |