mRNA_D-dichotoma_M_contig101.168.1 (mRNA) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig101.168.1 vs. uniprot
Match: A0A6H5KJI9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJI9_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 3.030e-7 Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 13 VAAFKGYWCHIISPVFFGRSVCSRRVNNAGGRRRQVHALAEDNNATAPS 159 ++ ++GYWCH ISPVFFGRSV RR+ RRRQ +A A PS Sbjct: 729 LSTWEGYWCHSISPVFFGRSVLGRRITKDMARRRQEEEVATAQLAATPS 777
BLAST of mRNA_D-dichotoma_M_contig101.168.1 vs. uniprot
Match: D7G5G5_ECTSI (Serine/threonine-protein kinase Nek3 (NimA-related protein kinase 3) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5G5_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 1.060e-6 Identity = 24/54 (44.44%), Postives = 30/54 (55.56%), Query Frame = 1 Query: 1 ENDAVAAFKGYWCHIISPVFFGRSVCSRRVNNAGGRRRQVHALAEDNNATAPSG 162 ++ ++GYWCH +SPVFFGRSV R + RRRQ A A PSG Sbjct: 306 RGRVLSTWEGYWCHSLSPVFFGRSVLGRHMTKEMARRRQEEDAAAAQLAATPSG 359 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig101.168.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dichotoma_M_contig101.168.1 >prot_D-dichotoma_M_contig101.168.1 ID=prot_D-dichotoma_M_contig101.168.1|Name=mRNA_D-dichotoma_M_contig101.168.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=70bp ENDAVAAFKGYWCHIISPVFFGRSVCSRRVNNAGGRRRQVHALAEDNNATback to top mRNA from alignment at D-dichotoma_M_contig101:552054..553401- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dichotoma_M_contig101.168.1 ID=mRNA_D-dichotoma_M_contig101.168.1|Name=mRNA_D-dichotoma_M_contig101.168.1|organism=Dictyota dichotoma ODC1387m male|type=mRNA|length=1348bp|location=Sequence derived from alignment at D-dichotoma_M_contig101:552054..553401- (Dictyota dichotoma ODC1387m male)back to top Coding sequence (CDS) from alignment at D-dichotoma_M_contig101:552054..553401- >mRNA_D-dichotoma_M_contig101.168.1 ID=mRNA_D-dichotoma_M_contig101.168.1|Name=mRNA_D-dichotoma_M_contig101.168.1|organism=Dictyota dichotoma ODC1387m male|type=CDS|length=420bp|location=Sequence derived from alignment at D-dichotoma_M_contig101:552054..553401- (Dictyota dichotoma ODC1387m male)back to top |