prot_D-dudresnayi_contig9968.28773.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9968.28773.1 vs. uniprot
Match: D8LBN4_ECTSI (V-SNARE coiled-coil homology domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBN4_ECTSI) HSP 1 Score: 97.1 bits (240), Expect = 3.830e-22 Identity = 49/54 (90.74%), Postives = 53/54 (98.15%), Query Frame = 0 Query: 2 HAAVSEARDLAIERGEKLDNLVDKSRQLEDSAMAFGDMAKQLRRQQEDESCCIS 55 HAA SEARDLAIERGEKL+NLVD+SRQLEDSAMAFGDMAKQLR+QQEDE+CCIS Sbjct: 1416 HAAASEARDLAIERGEKLENLVDRSRQLEDSAMAFGDMAKQLRKQQEDEACCIS 1469
BLAST of mRNA_D-dudresnayi_contig9968.28773.1 vs. uniprot
Match: A0A7K7KTK9_9AVES (VAMP4 protein (Fragment) n=1 Tax=Asarcornis scutulata TaxID=75869 RepID=A0A7K7KTK9_9AVES) HSP 1 Score: 45.4 bits (106), Expect = 6.960e-5 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 13 IERGEKLDNLVDKSRQLEDSAMAFGDMAKQLRRQQEDESCCIS 55 IERGE+LD+L DKS L D+A AF + AKQLRRQ C +S Sbjct: 20 IERGERLDDLQDKSESLSDNATAFSNRAKQLRRQMWWRGCKVS 62 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9968.28773.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9968.28773.1 ID=prot_D-dudresnayi_contig9968.28773.1|Name=mRNA_D-dudresnayi_contig9968.28773.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|