prot_D-dudresnayi_contig9886.28700.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9886.28700.1 vs. uniprot
Match: A0A2G2E1Y8_9FLAO (Acetyltransferase component of pyruvate dehydrogenase complex n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2E1Y8_9FLAO) HSP 1 Score: 53.9 bits (128), Expect = 2.570e-5 Identity = 38/130 (29.23%), Postives = 64/130 (49.23%), Query Frame = 0 Query: 1 GTVQNWSIKVGDSFRKGDRLCDIVLPVATIGIDAKSDGIMANIVVGRYETAPADSPIALYALSKDYYMGYLAESMQNASDAAKMEIVTAAEEEEKPHKPDAADLMRVIRQMTQQ--GRIESGMFAKKLQS 128 G V +W+ KVGD +G+ L +I AT+ ++ DG++ +I VG+ ETAP ++ +A+ + LAE+ K E EE KP AA + ++ + GR+ + A+K+ S Sbjct: 17 GVVADWNKKVGDEVSEGELLAEIETDKATMEFESFYDGVLLHIGVGKGETAPVNTLLAIIGDKGEDIEKILAEAKNPTKAEVKEENAPEKEEAAPVVKPTAASVPTPVQAAVTESNGRVFASPLARKMAS 146 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9886.28700.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9886.28700.1 ID=prot_D-dudresnayi_contig9886.28700.1|Name=mRNA_D-dudresnayi_contig9886.28700.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=176bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|