prot_D-dudresnayi_contig9399.28198.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9399.28198.1 vs. uniprot
Match: A0A6H5KG36_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KG36_9PHAE) HSP 1 Score: 112 bits (281), Expect = 2.980e-27 Identity = 51/81 (62.96%), Postives = 58/81 (71.60%), Query Frame = 0 Query: 1 MHYHPECLDPPMTPRELSPYASGKLAWCCDGCQVCVGCGCAND--LRENGVSLTCTERGKVHHAHLDEPEGAEPGPRANEK 79 MHYHP CLDPPMTPRE++ +A K W CD CQ C GCG N+ +R G L C ERGKVHH HLD PEG++PGPRA EK Sbjct: 1337 MHYHPGCLDPPMTPREIASHAHSKEEWRCDYCQTCQGCGKGNEGEMRRGGDPLVCHERGKVHHVHLDAPEGSDPGPRAQEK 1417
BLAST of mRNA_D-dudresnayi_contig9399.28198.1 vs. uniprot
Match: D8LHU3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHU3_ECTSI) HSP 1 Score: 112 bits (280), Expect = 4.070e-27 Identity = 51/81 (62.96%), Postives = 57/81 (70.37%), Query Frame = 0 Query: 1 MHYHPECLDPPMTPRELSPYASGKLAWCCDGCQVCVGCGCAND--LRENGVSLTCTERGKVHHAHLDEPEGAEPGPRANEK 79 MHYHP CLDPPMTPRE++ +A K W CD CQ C GCG N+ +R G L C ERGKVHH HLD PEG +PGPRA EK Sbjct: 1094 MHYHPGCLDPPMTPREIASHAHSKEEWRCDYCQTCQGCGKGNEDEMRRGGDPLVCHERGKVHHVHLDAPEGCDPGPRAQEK 1174 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9399.28198.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9399.28198.1 ID=prot_D-dudresnayi_contig9399.28198.1|Name=mRNA_D-dudresnayi_contig9399.28198.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=79bpback to top |