prot_D-dudresnayi_contig9375.28171.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9375.28171.1 vs. uniprot
Match: D7FHV7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHV7_ECTSI) HSP 1 Score: 103 bits (256), Expect = 6.220e-27 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 0 Query: 3 GKIDPITFIDQITRLELCALEVFLRRRTESGDADKTSPPSELSTVLLGSDLAEAFPEARVERVSAGGVLP 72 G ID + FIDQ+TRL LCALE+FLRRRT SGDA KT P +L +V+LG DLA AFPEARV+RV AGGV+P Sbjct: 27 GDIDCVIFIDQVTRLALCALEIFLRRRTSSGDAAKTPAPGDLGSVVLGEDLAVAFPEARVKRVCAGGVMP 96 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9375.28171.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9375.28171.1 ID=prot_D-dudresnayi_contig9375.28171.1|Name=mRNA_D-dudresnayi_contig9375.28171.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=78bpback to top |