prot_D-dudresnayi_contig10223.265.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10223.265.1 vs. uniprot
Match: D7FPM9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPM9_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 4.980e-12 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 1 MFFEGLSVFPVLYLDDDLCVFQFKAAGTVVASHRV 35 MFF+GLSVFPV YLDDD CVF+FKAAGTVVAS R+ Sbjct: 232 MFFDGLSVFPVHYLDDDFCVFEFKAAGTVVASQRI 266
BLAST of mRNA_D-dudresnayi_contig10223.265.1 vs. uniprot
Match: A0A7S1YML6_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S1YML6_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 5.950e-6 Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 1 MFFEGLSVFPVLYLDDDLCVFQFKAAGTVVASHRV 35 MF E +SVFPV Y+DDDLCVF F+ GT + + ++ Sbjct: 251 MFLESVSVFPVSYMDDDLCVFDFELLGTRIVARKI 285
BLAST of mRNA_D-dudresnayi_contig10223.265.1 vs. uniprot
Match: A0A6U0ESK7_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A6U0ESK7_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 2.920e-5 Identity = 19/34 (55.88%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 2 FFEGLSVFPVLYLDDDLCVFQFKAAGTVVASHRV 35 F E +SVFP+ YLDDDLCVF F+ GT + + +V Sbjct: 255 FLEQVSVFPISYLDDDLCVFDFELLGTRICARKV 288 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10223.265.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10223.265.1 ID=prot_D-dudresnayi_contig10223.265.1|Name=mRNA_D-dudresnayi_contig10223.265.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=39bpback to top |