prot_D-dudresnayi_contig9999.28808.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9999.28808.1 vs. uniprot
Match: A0A6H5L742_9PHAE (ENDO3c domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L742_9PHAE) HSP 1 Score: 105 bits (261), Expect = 2.480e-23 Identity = 47/67 (70.15%), Postives = 55/67 (82.09%), Query Frame = 0 Query: 112 SSVVMVQVPEDFSFAQAACSYGYYLVPPNRWEPCKKNPDDRDAGTFSRPLRFGERLAKTALCVISQV 178 SSVVMV+VP+ FSF QAACSYGY++VPPN W+PC+ P RD+GTFSRPLRFG+RL TA C IS V Sbjct: 79 SSVVMVKVPQGFSFTQAACSYGYFVVPPNLWQPCESAPGLRDSGTFSRPLRFGQRLVNTAKCTISLV 145
BLAST of mRNA_D-dudresnayi_contig9999.28808.1 vs. uniprot
Match: A0A0G4H2A2_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4H2A2_VITBC) HSP 1 Score: 55.8 bits (133), Expect = 6.810e-6 Identity = 29/75 (38.67%), Postives = 43/75 (57.33%), Query Frame = 0 Query: 94 QRSLCTEGKEKRTDGTSASSV-VMVQVPEDFSFAQAACSYGYYLVPPNRWEPCKKNPD-DRDAGTFSRPLRFGER 166 Q S T ++D +S V V + V +DF A++ CSYG++++ PN+W C P D G F RPLR+GE+ Sbjct: 16 QSSQSTTDGSTQSDSSSLREVSVTIDVADDFDLAKSICSYGFFVLAPNKW--CPPPPSLSTDHGVFKRPLRYGEK 88 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9999.28808.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9999.28808.1 ID=prot_D-dudresnayi_contig9999.28808.1|Name=mRNA_D-dudresnayi_contig9999.28808.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=187bpback to top |