prot_D-dudresnayi_contig9997.28807.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: A0A6H5KVU5_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVU5_9PHAE) HSP 1 Score: 117 bits (293), Expect = 4.590e-29 Identity = 58/69 (84.06%), Postives = 61/69 (88.41%), Query Frame = 0 Query: 1 LLEFWANEGRPLYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 LLEFWA EG+ LYPNM R ARVLLSVP SSA LERDF TAGRLITGARSRLSAAY E+VLFLNGN+EYI Sbjct: 712 LLEFWAGEGQALYPNMARAARVLLSVPASSAVLERDFSTAGRLITGARSRLSAAYVEMVLFLNGNQEYI 780
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: A0A225UGF7_9STRA (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225UGF7_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 4.690e-11 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 0 Query: 1 LLEFWANEGRP-LYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 +L FW + + + VARVL S+P+SSA +ERDFGTAGR++T RS L+ ++ FLN NR Y+ Sbjct: 23 VLSFWKRQQEQGNFRLLPLVARVLFSIPSSSAQIERDFGTAGRMVTSQRSSLAPCNVDMTTFLNCNRTYV 92
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: A0A080YX20_PHYPR (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Phytophthora parasitica P1976 TaxID=1317066 RepID=A0A080YX20_PHYPR) HSP 1 Score: 62.8 bits (151), Expect = 1.340e-10 Identity = 29/70 (41.43%), Postives = 46/70 (65.71%), Query Frame = 0 Query: 1 LLEFWANEGRP-LYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 +LEFW + Y + +V R+L ++PTSSA +ERDFGTAG+L+T R ++ ++ FLN NR+++ Sbjct: 83 ILEFWQRQAASNTYTFLPQVVRILFAIPTSSAQIERDFGTAGQLVTPQRGSIAPYNVDMSAFLNCNRQFV 152
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: A0A0W8D5H4_PHYNI (Dimer_Tnp_hAT domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A0W8D5H4_PHYNI) HSP 1 Score: 60.5 bits (145), Expect = 2.050e-9 Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 0 Query: 1 LLEFWANEGRP-LYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 +L +W + + + VARVL S+P+SSA +ERDFGTAGR++T RS L ++ ++LN NR Y+ Sbjct: 139 VLSYWKRQQEQGNFQLLPLVARVLFSMPSSSAQIERDFGTAGRMVTPERSSLEPYNVDMAMYLNCNRSYV 208
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: V9F663_PHYPR (Dimer_Tnp_hAT domain-containing protein n=4 Tax=Phytophthora parasitica TaxID=4792 RepID=V9F663_PHYPR) HSP 1 Score: 59.7 bits (143), Expect = 3.950e-9 Identity = 28/70 (40.00%), Postives = 45/70 (64.29%), Query Frame = 0 Query: 1 LLEFWANEGRP-LYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 +LEFW + Y + +V R+L ++PTSSA +ERDFGTAG+L+T R ++ ++ FLN N +++ Sbjct: 87 ILEFWQRQAASNTYTFLPQVVRILFAIPTSSAQIERDFGTAGQLVTPQRGSIAPYNVDMSAFLNCNWQFV 156
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: W2JRK8_PHYPR (Dimer_Tnp_hAT domain-containing protein n=2 Tax=Phytophthora parasitica TaxID=4792 RepID=W2JRK8_PHYPR) HSP 1 Score: 60.5 bits (145), Expect = 4.850e-9 Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 0 Query: 1 LLEFWANEGRP-LYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 +L +W + + + VARVL S+P+SSA +ERDFGTAGR++T RS L ++ ++LN NR Y+ Sbjct: 445 VLSYWKRQQEQGNFQLLPLVARVLFSMPSSSAQIERDFGTAGRMVTPERSSLEPYNVDMAMYLNCNRSYV 514
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: W2QQF5_PHYPN (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Phytophthora parasitica (strain INRA-310) TaxID=761204 RepID=W2QQF5_PHYPN) HSP 1 Score: 59.7 bits (143), Expect = 8.990e-9 Identity = 28/51 (54.90%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 19 VARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 VARVL S+P+SSA +ERDFGTAGR++T RS L ++ ++LN NR Y+ Sbjct: 386 VARVLFSMPSSSAQIERDFGTAGRMVTPERSSLEPYNVDMAMYLNCNRSYV 436
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: UPI0019661A93 (zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 n=1 Tax=Polypterus senegalus TaxID=55291 RepID=UPI0019661A93) HSP 1 Score: 58.9 bits (141), Expect = 9.620e-9 Identity = 30/65 (46.15%), Postives = 44/65 (67.69%), Query Frame = 0 Query: 1 LLEFWANEGRPLYPNMTRVARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGN 65 LL +W E ++P++ R+AR +LS+P +SA ERDF TAG +I+ RS+LS + VLFL+ N Sbjct: 170 LLNWW-KEHSEMFPSLARIARSILSIPATSATSERDFSTAGCVISERRSQLSPETVDDVLFLHSN 233
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: W2PE29_PHYPN (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Phytophthora parasitica (strain INRA-310) TaxID=761204 RepID=W2PE29_PHYPN) HSP 1 Score: 58.2 bits (139), Expect = 9.680e-9 Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 19 VARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 VARVL S+P+SSA +ERDFG AGR++T RS L+ ++ FLN NR Y+ Sbjct: 71 VARVLFSMPSSSAQIERDFGAAGRMVTPQRSSLAPYNVDMATFLNCNRSYV 121
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Match: H3GTQ6_PHYRM (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GTQ6_PHYRM) HSP 1 Score: 57.0 bits (136), Expect = 9.910e-9 Identity = 27/51 (52.94%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 19 VARVLLSVPTSSAFLERDFGTAGRLITGARSRLSAAYAEVVLFLNGNREYI 69 VARV+ S+P+SSA +ERDFGTAGR++T R+ L++ ++ FLN NR Y+ Sbjct: 10 VARVVFSLPSSSAQIERDFGTAGRMVTPQRNSLASHNVDMTTFLNCNRCYV 60 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9997.28807.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9997.28807.1 ID=prot_D-dudresnayi_contig9997.28807.1|Name=mRNA_D-dudresnayi_contig9997.28807.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=69bpback to top |