prot_D-dudresnayi_contig982.28626.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A7S3M3Y9_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3M3Y9_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 2.210e-18 Identity = 45/67 (67.16%), Postives = 49/67 (73.13%), Query Frame = 0 Query: 20 MHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRR-------GGDRYDRGGHRGGY 79 MHGAD+DGRSI+VEKARR GY KTPGVYLGP LSARF R D+R GGDR GG+RGGY Sbjct: 1 MHGADLDGRSIRVEKARRNNGYQKTPGVYLGPPQLSARFVRGDERGPPRDRGYGGDRPQGGGYRGGY 67
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A835YLG8_9STRA (RRM domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YLG8_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 2.090e-14 Identity = 36/68 (52.94%), Postives = 47/68 (69.12%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRD-DDRRGG 67 GFGFV++ N+D+ A M GA + GR IKVE +RRAGG+ +TPG Y GP G SA++ + D RRGG Sbjct: 116 GFGFVTYENVDDARTAAREMEGATIQGRKIKVEISRRAGGHARTPGEYRGPPGASAKYGSERDSRRGG 183
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A421GKY9_9STRA (RRM domain-containing protein n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A421GKY9_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 4.310e-11 Identity = 30/64 (46.88%), Postives = 44/64 (68.75%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDR 64 GFGFV+F ++ + E A+ ++G ++ GRSI+VE A+R G+ KTPG YLGP SA++ DR Sbjct: 119 GFGFVTFEDVRDAEDAVKEINGKEIQGRSIRVEHAKRKRGHEKTPGQYLGPRLASAKYGMGRDR 182
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: S3CBW7_OPHP1 (Transformer-sr ribonucleoprotein n=1 Tax=Ophiostoma piceae (strain UAMH 11346) TaxID=1262450 RepID=S3CBW7_OPHP1) HSP 1 Score: 65.9 bits (159), Expect = 8.360e-11 Identity = 41/90 (45.56%), Postives = 47/90 (52.22%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGP------AGLSA-----RFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV D+ + A D + G +DGRS+ +EKARRA TPG Y GP G S RF R DDRR RGG RGGY Sbjct: 120 GFGFVKMVTSDQADAAKDGLQGEVIDGRSLSIEKARRARPRTPTPGKYFGPPKRDPRGGGSVXXXXXRFDRFDDRR------RGGERGGY 203
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A0F7ZPK4_9HYPO (RRM domain-containing protein n=1 Tax=Hirsutella minnesotensis 3608 TaxID=1043627 RepID=A0A0F7ZPK4_9HYPO) HSP 1 Score: 64.3 bits (155), Expect = 2.620e-10 Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV D+ E A + + G ++GR++ +EKARRA TPG Y GP R DD RRGG Y GG GGY Sbjct: 117 GFGFVKMVTSDQAEAAKEGLQGEQIEGRTLSIEKARRARPRTPTPGKYFGPPKREPRGRFDDRRRGG--Y--GGGAGGY 191
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: M1WCP5_CLAP2 (Related to TATA-binding protein associated factor 2N n=1 Tax=Claviceps purpurea (strain 20.1) TaxID=1111077 RepID=M1WCP5_CLAP2) HSP 1 Score: 63.9 bits (154), Expect = 3.790e-10 Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV D+ E A + + G ++GR++ +EKARRA TPG Y GP R DD RRGG Y GG GGY Sbjct: 117 GFGFVKMVTSDQAEAAKEGLQGEQIEGRTLSIEKARRARPRTPTPGKYFGPPKRDPRPRFDDRRRGG--Y--GGGAGGY 191
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A0A1TSQ0_9HYPO (Putative RNA recognition domain-containing protein n=1 Tax=Torrubiella hemipterigena TaxID=1531966 RepID=A0A0A1TSQ0_9HYPO) HSP 1 Score: 63.2 bits (152), Expect = 7.090e-10 Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV D+ E A + + G ++GR++ +EKARRA TPG Y GP +R R DDRR RGG+ GGY Sbjct: 117 GFGFVKMVTSDQAEAAKEGLQGEQIEGRTMSIEKARRARPRTPTPGKYFGPPKRESR-PRFDDRR------RGGYGGGY 188
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A0A1TRJ1_9HYPO (Putative RNA recognition domain-containing protein n=1 Tax=Torrubiella hemipterigena TaxID=1531966 RepID=A0A0A1TRJ1_9HYPO) HSP 1 Score: 63.2 bits (152), Expect = 7.200e-10 Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV D+ E A + + G ++GR++ +EKARRA TPG Y GP +R R DDRR RGG+ GGY Sbjct: 122 GFGFVKMVTSDQAEAAKEGLQGEQIEGRTMSIEKARRARPRTPTPGKYFGPPKRESR-PRFDDRR------RGGYGGGY 193
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A2T3YU75_9HYPO (RRM domain-containing protein n=2 Tax=Trichoderma asperellum TaxID=101201 RepID=A0A2T3YU75_9HYPO) HSP 1 Score: 63.2 bits (152), Expect = 7.330e-10 Identity = 34/79 (43.04%), Postives = 44/79 (55.70%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGGDRYDRGGHRGGY 79 GFGFV ++ E A + + G ++GR++ +EKARRA TPG Y GP R DD RRGG Y GG+R Y Sbjct: 116 GFGFVKMVTSEQAEAAKEGLQGEVIEGRTMSIEKARRARPRTPTPGKYFGPPKRDPRSRFDDRRRGG--YGGGGYRDDY 192
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Match: A0A1Y2WS82_9PEZI (RRM domain-containing protein n=4 Tax=Hypoxylaceae TaxID=2033035 RepID=A0A1Y2WS82_9PEZI) HSP 1 Score: 63.2 bits (152), Expect = 7.400e-10 Identity = 30/67 (44.78%), Postives = 39/67 (58.21%), Query Frame = 0 Query: 1 GFGFVSFANIDECEKALDAMHGADVDGRSIKVEKARRAGGYNKTPGVYLGPAGLSARFTRDDDRRGG 67 GFGFV D+ + A D + G +++GR++ +EKARRA TPG Y GP R DD RRGG Sbjct: 117 GFGFVKMVTSDQADAAKDGLQGEEIEGRTLSIEKARRARPRTPTPGKYFGPPKREGRPRFDDRRRGG 183 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig982.28626.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig982.28626.1 ID=prot_D-dudresnayi_contig982.28626.1|Name=mRNA_D-dudresnayi_contig982.28626.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=80bpback to top |