prot_D-dudresnayi_contig973.28514.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig973.28514.1 vs. uniprot
Match: D7G0X2_ECTSI (HDAC_interact domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0X2_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 6.130e-7 Identity = 41/95 (43.16%), Postives = 49/95 (51.58%), Query Frame = 0 Query: 1 PQGDRSRKKKLLLGGGKRAVPQ---------------------------VLQLETLEVLARAKMPHLGSDLVEGGQPEIFAEFKRVAIETEMDNE 68 P+G SRKKKL +G G RAVPQ VLQL+ LEVLAR +M HL SDL+E PE++AEFKR+ E E Sbjct: 220 PRG--SRKKKLYIGSGDRAVPQTTEQELMSSIKHALMSAGREYWDEFTKVLQLQKLEVLARDEMLHLVSDLLESNHPELYAEFKRMVKEASQQGE 312 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig973.28514.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig973.28514.1 ID=prot_D-dudresnayi_contig973.28514.1|Name=mRNA_D-dudresnayi_contig973.28514.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=189bpback to top |