prot_D-dudresnayi_contig9726.28506.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9726.28506.1 vs. uniprot
Match: D7G277_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G277_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 1.130e-7 Identity = 37/98 (37.76%), Postives = 52/98 (53.06%), Query Frame = 0 Query: 7 VEAGELGWVEVPAQD-SSLSESDGCNALGCVEENTRDGSLEADDRWSCQYDSREDDDRTFDSRCRVTYTLPYAVDLYSLNIAFYEGDSETVTLMVLVD 103 VEAGE+ V V + ++ DGC GC ENTRDG L + RWSC E C+V + L A + S+++AF +GD+ T TL + V+ Sbjct: 248 VEAGEVTTVTVTTNAFDARTDDDGCAPDGCTGENTRDGDLTDNSRWSCSAGLVEAAGGAAGEECQVMFELGEAQLVTSVSVAFLKGDTRTRTLNINVN 345 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9726.28506.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9726.28506.1 ID=prot_D-dudresnayi_contig9726.28506.1|Name=mRNA_D-dudresnayi_contig9726.28506.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=111bpback to top |