prot_D-dudresnayi_contig947.28273.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig947.28273.1 vs. uniprot
Match: A0A815A0Z9_9BILA (N-acetyl-D-glucosamine kinase n=6 Tax=Rotaria TaxID=231623 RepID=A0A815A0Z9_9BILA) HSP 1 Score: 53.5 bits (127), Expect = 5.470e-5 Identity = 40/139 (28.78%), Postives = 64/139 (46.04%), Query Frame = 0 Query: 32 LTAFAEKCPQLEEL-SLDCPQLTDQSVIALAQHCSRLKKLKLNGCKLTLQEQCCAGLESLIIADTNITPQQLSELVRAFPQLHTLGIDHPTCSSDVVLVELARSCPH--LQKVTLHCLCSMTEDGVLTLAAHCRQLREI 167 L+ F ++ P L ++ +L C +TD+SVI++ HCSRL +L L GC AG+ L R L +L + + D L+ + +S H L ++ L +T+DG L L +C L+ I Sbjct: 476 LSQFVQQYPSLRKIRALHCSHITDESVISIGSHCSRLMELDLTGCIKVTD----AGINGL----------------RQLTHLRSLALTQIPITDDS-LISIGQSAFHHTLNEINLRMCTEITDDGFLFLLKNCPNLKTI 593 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig947.28273.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig947.28273.1 ID=prot_D-dudresnayi_contig947.28273.1|Name=mRNA_D-dudresnayi_contig947.28273.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=192bpback to top |