prot_D-dudresnayi_contig1059.670.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig1059.670.1 vs. uniprot
Match: D8LG39_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LG39_ECTSI) HSP 1 Score: 99.0 bits (245), Expect = 5.620e-19 Identity = 49/64 (76.56%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 279 AVAEERLTAWLSGLKIRRPDAMRYAASLMADGFDSGEALRGVREEDLMHYDMKKGHARLVVRTL 342 A ERL AWLSGLKIR PDA RYA L+ADGFDS EALRGVREE+L+ Y MKKGHARLVVR L Sbjct: 821 AAVVERLAAWLSGLKIREPDASRYAGRLVADGFDSEEALRGVREEELLQYGMKKGHARLVVRLL 884
BLAST of mRNA_D-dudresnayi_contig1059.670.1 vs. uniprot
Match: A0A6H5JAE9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAE9_9PHAE) HSP 1 Score: 97.8 bits (242), Expect = 8.700e-19 Identity = 48/64 (75.00%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 279 AVAEERLTAWLSGLKIRRPDAMRYAASLMADGFDSGEALRGVREEDLMHYDMKKGHARLVVRTL 342 AV +RL WLSGLKIR PDA RYA L+ADGFDS EALRGVREE+L+ Y MKKGHARLVVR L Sbjct: 447 AVVVQRLATWLSGLKIREPDASRYAGRLVADGFDSEEALRGVREEELLQYGMKKGHARLVVRLL 510 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig1059.670.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig1059.670.1 ID=prot_D-dudresnayi_contig1059.670.1|Name=mRNA_D-dudresnayi_contig1059.670.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=350bpback to top |