prot_D-dudresnayi_contig10528.578.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A7J7QR03_9CHLO (Flagellar WD repeat-containing protein Pf20 n=1 Tax=Scenedesmus sp. NREL 46B-D3 TaxID=2650976 RepID=A0A7J7QR03_9CHLO) HSP 1 Score: 73.6 bits (179), Expect = 4.650e-14 Identity = 28/46 (60.87%), Postives = 38/46 (82.61%), Query Frame = 0 Query: 2 TFTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 T +DH QAVW ++H GD++ASCS+DH+VR+WDL +GKC+Q LRG Sbjct: 421 TLSDHKQAVWSVKYHDQGDWLASCSLDHSVRLWDLSSGKCRQVLRG 466
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: K9SIB4_9CYAN ((Myosin heavy-chain) kinase n=1 Tax=Pseudanabaena sp. PCC 7367 TaxID=82654 RepID=K9SIB4_9CYAN) HSP 1 Score: 53.1 bits (126), Expect = 7.280e-7 Identity = 21/44 (47.73%), Postives = 28/44 (63.64%), Query Frame = 0 Query: 3 FTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLR 46 F H + + E P G+ + SC DHT+RIWDL+AG+C Q LR Sbjct: 139 FNGHNRPISDLEITPDGNQLISCGEDHTIRIWDLVAGRCHQILR 182
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A139WWZ1_9CYAN (Ricin B-type lectin domain-containing protein n=1 Tax=Scytonema hofmannii PCC 7110 TaxID=128403 RepID=A0A139WWZ1_9CYAN) HSP 1 Score: 52.8 bits (125), Expect = 8.020e-7 Identity = 20/40 (50.00%), Postives = 25/40 (62.50%), Query Frame = 0 Query: 6 HTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTL 45 HT +VW F P G +ASCS+D T+RIWD+ G C L Sbjct: 8 HTDSVWSVAFSPNGQLLASCSLDRTIRIWDVSNGNCLHIL 47
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A2W4WEI6_9CYAN (NB-ARC domain-containing protein n=2 Tax=Pseudanabaena TaxID=1152 RepID=A0A2W4WEI6_9CYAN) HSP 1 Score: 52.4 bits (124), Expect = 1.370e-6 Identity = 24/42 (57.14%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 6 HTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 HT V F P G F+AS S D TVR+WD++ GKC QTLRG Sbjct: 948 HTAWVRMVSFSPDGHFLASGSEDQTVRLWDVLTGKCLQTLRG 989
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A1I8JNG7_9PLAT (WD_REPEATS_REGION domain-containing protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8JNG7_9PLAT) HSP 1 Score: 51.2 bits (121), Expect = 3.500e-6 Identity = 21/39 (53.85%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 9 AVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 AVW ++H G+F+AS SMD+TVR++DL + +C+Q LRG Sbjct: 365 AVWSLQYHWTGNFIASASMDNTVRLFDLGSVRCRQILRG 403
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A355CFX2_9CYAN (CHAT domain-containing protein n=2 Tax=unclassified Microcoleaceae TaxID=2053578 RepID=A0A355CFX2_9CYAN) HSP 1 Score: 50.1 bits (118), Expect = 8.950e-6 Identity = 18/45 (40.00%), Postives = 27/45 (60.00%), Query Frame = 0 Query: 1 HTFTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTL 45 HT TDH+ + HP G ASCS+D T+++W+L G+ + L Sbjct: 389 HTLTDHSDIIKSVAIHPDGQIFASCSLDQTIKVWNLTTGELLENL 433
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: UPI001BAEFCD3 (NB-ARC domain-containing protein n=2 Tax=Acaryochloris TaxID=155977 RepID=UPI001BAEFCD3) HSP 1 Score: 49.3 bits (116), Expect = 1.680e-5 Identity = 22/49 (44.90%), Postives = 30/49 (61.22%), Query Frame = 0 Query: 1 HTFT--DHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 H FT H +W F G +AS S+DHT+++W+L +G C QTLRG Sbjct: 607 HQFTLPGHKVLIWTIAFSDDGCLLASGSIDHTIKVWNLKSGSCVQTLRG 655
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: A0A430Q5X4_SCHBO (Platelet-activating factor acetylhydrolase IB subunit alpha n=1 Tax=Schistosoma bovis TaxID=6184 RepID=A0A430Q5X4_SCHBO) HSP 1 Score: 48.1 bits (113), Expect = 1.940e-5 Identity = 20/46 (43.48%), Postives = 29/46 (63.04%), Query Frame = 0 Query: 2 TFTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 TF HT+ + P G+ +ASCS DHT+RIW + + +C+ LRG Sbjct: 19 TFIGHTEWIRSVRPSPEGNLLASCSNDHTIRIWSVESRECQVVLRG 64
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: UPI001C017AC0 (quinon protein alcohol dehydrogenase-like superfamily n=1 Tax=Suillus subaureus TaxID=48587 RepID=UPI001C017AC0) HSP 1 Score: 48.9 bits (115), Expect = 2.270e-5 Identity = 19/38 (50.00%), Postives = 26/38 (68.42%), Query Frame = 0 Query: 3 FTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGK 40 F HT VWG PGG + +CSMDH++R+W+L +GK Sbjct: 6 FEGHTGDVWGVIHLPGGQRIITCSMDHSMRVWNLKSGK 43
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Match: B0C7R2_ACAM1 (WD-repeat protein n=2 Tax=Acaryochloris TaxID=155977 RepID=B0C7R2_ACAM1) HSP 1 Score: 48.9 bits (115), Expect = 2.300e-5 Identity = 19/46 (41.30%), Postives = 29/46 (63.04%), Query Frame = 0 Query: 2 TFTDHTQAVWGSEFHPGGDFVASCSMDHTVRIWDLIAGKCKQTLRG 47 T + H + F G +ASCS+DHT++IW++ +G C QTL+G Sbjct: 611 TLSSHKVLILSITFSNDGCLIASCSVDHTIKIWNVKSGSCIQTLKG 656 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10528.578.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 19
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10528.578.1 ID=prot_D-dudresnayi_contig10528.578.1|Name=mRNA_D-dudresnayi_contig10528.578.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=47bpback to top |