prot_D-dudresnayi_contig10518.565.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10518.565.1 vs. uniprot
Match: D7G7A4_ECTSI (Similar to chromodomain helicase DNA binding protein 4 isoform 5 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7A4_ECTSI) HSP 1 Score: 78.6 bits (192), Expect = 9.800e-15 Identity = 40/55 (72.73%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 1 LFGDRPADSGAGWEKILGKSYKLDQKKQQARLGRGKREKTQVRLYAADEAQPSPS 55 LFG+RPADSGAGWE+IL KSYK Q Q ARLGRGKREKTQVR YAA+E + P+ Sbjct: 1459 LFGERPADSGAGWEEILAKSYKEQQTSQAARLGRGKREKTQVRPYAAEEDEHDPT 1513
BLAST of mRNA_D-dudresnayi_contig10518.565.1 vs. uniprot
Match: A0A6H5JZW8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZW8_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.000e-13 Identity = 54/113 (47.79%), Postives = 61/113 (53.98%), Query Frame = 0 Query: 1 LFGDRPADSGAGWEKILGKSYKLDQKKQQARLGRGKREKTQ----VRLYAADE-----AQPSPSADEDGSI-------------------------EFEPEQPDAEFEMPSSK 79 LFG+RPADSGAGWE+IL KSYK Q Q ARLGRGKREKTQ VR YAA+E A +GS+ E+ EQPDAEFE P+SK Sbjct: 1358 LFGERPADSGAGWEEILAKSYKEHQTSQAARLGRGKREKTQASRQVRPYAAEEDEHDAANHGGGGSSNGSLRHGEEGRXXXXXXXXXXXXXXXXXXEYGSEQPDAEFEPPTSK 1470 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10518.565.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10518.565.1 ID=prot_D-dudresnayi_contig10518.565.1|Name=mRNA_D-dudresnayi_contig10518.565.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=107bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|