prot_D-dudresnayi_contig10451.489.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10451.489.1 vs. uniprot
Match: D7G7L2_ECTSI (G-patch_2 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G7L2_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 7.510e-18 Identity = 58/103 (56.31%), Postives = 70/103 (67.96%), Query Frame = 0 Query: 1 MKSSKPKNGFSMSLSKGKPPN-----AKG-QRSDSGNTKRS--AIGDTHGEDDDASAAPRKDFVTGIGGGKVVTREITVDRGPRVIALATNPWERAAAEAAAA 95 M SSKPK GFSMSL K K + AKG R+ SG +K S AIG H ++D ++D+VTGIGGGKVVT+E+ VDRGPRVIALA+NPW + AAAA Sbjct: 1 MASSKPKKGFSMSLGKPKQSSSSATSAKGPDRATSGGSKSSTSAIGVAHDDEDAGGRGGKRDYVTGIGGGKVVTKEVVVDRGPRVIALASNPWANGSNAAAAA 103 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10451.489.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10451.489.1 ID=prot_D-dudresnayi_contig10451.489.1|Name=mRNA_D-dudresnayi_contig10451.489.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=108bpback to top |