prot_D-dudresnayi_contig10312.340.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10312.340.1 vs. uniprot
Match: A0A6H5KR89_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KR89_9PHAE) HSP 1 Score: 89.0 bits (219), Expect = 2.810e-21 Identity = 43/57 (75.44%), Postives = 49/57 (85.96%), Query Frame = 0 Query: 16 TDKFGGTVVNFREQEKETFFKSKGIEGDVDSFNWDELRRNTREIENLQKAAVQRYWK 72 T K G V NFRE+EKETFFKSKGIEGDVDSF+WDELRRNT EIE LQ+ AV++YW+ Sbjct: 23 TRKLGAAVDNFREREKETFFKSKGIEGDVDSFDWDELRRNTDEIEQLQREAVEQYWR 79 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10312.340.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10312.340.1 ID=prot_D-dudresnayi_contig10312.340.1|Name=mRNA_D-dudresnayi_contig10312.340.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=88bpback to top |