prot_D-dudresnayi_contig10019.59.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10019.59.1 vs. uniprot
Match: A0A6H5L056_9PHAE (NUC194 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L056_9PHAE) HSP 1 Score: 97.8 bits (242), Expect = 6.290e-22 Identity = 50/91 (54.95%), Postives = 64/91 (70.33%), Query Frame = 0 Query: 1 LVAGTLGSDSPAVDPATKANALALIPFLRPCLTRKWKDYGHSTPCGSGEVDESSEGHRA----------LVLPALEEMVSRHFPIEDSREP 81 LVAGTLGS S VD +TKA+AL L+PFLRPCLTRK ++YGH+ P + ++ + G A LV+PALEEM+S HFPI++SREP Sbjct: 1672 LVAGTLGSSSSVVDASTKADALTLVPFLRPCLTRKARNYGHAVPHAGKQGEDGAGGAGASAGGKGKPDGLVMPALEEMMSMHFPIDNSREP 1762
BLAST of mRNA_D-dudresnayi_contig10019.59.1 vs. uniprot
Match: D8LKP7_ECTSI (Wu:fa96e12 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LKP7_ECTSI) HSP 1 Score: 91.7 bits (226), Expect = 9.160e-20 Identity = 49/92 (53.26%), Postives = 62/92 (67.39%), Query Frame = 0 Query: 1 LVAGTLGSDSPAVDPATKANALALIPFLRPCLTRKWKDYGHSTPC------GSGEVDESSEGHRA----LVLPALEEMVSRHFPIEDSREPA 82 LVA TLGS S VD +TKA+AL L+PFLRPC+TRK ++YGH+ P G S G + LV+PA+EEM+S HFPI++SREPA Sbjct: 2011 LVARTLGSSSSVVDASTKADALTLVPFLRPCITRKARNYGHAVPHAGRQGEGGXXXXXXSAGGKGKSDGLVMPAMEEMMSMHFPIDNSREPA 2102 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10019.59.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10019.59.1 ID=prot_D-dudresnayi_contig10019.59.1|Name=mRNA_D-dudresnayi_contig10019.59.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=82bpback to top |