mRNA_D-dudresnayi_contig9988.28793.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9988.28793.1 vs. uniprot
Match: UPI0005C9E314 (probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 n=1 Tax=Fragaria vesca subsp. vesca TaxID=101020 RepID=UPI0005C9E314) HSP 1 Score: 50.1 bits (118), Expect = 3.350e-6 Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 1 Query: 1 FISSLHIVSADLDGPIPECICMFTQLSVLVIHSCNASGPFPFWIDALAGLQKLDLSDNRLTGTV 192 ++ ++++ DL G IP T+L LV+ SCN +G P +I + L LDLS NRL GT+ Sbjct: 39 YLKQVNLLRNDLSGSIPR-EWASTKLEYLVLRSCNITGKIPEYISTMTNLTVLDLSFNRLEGTI 101
BLAST of mRNA_D-dudresnayi_contig9988.28793.1 vs. uniprot
Match: A0A699YZT6_HAELA (Uncharacterized protein n=1 Tax=Haematococcus lacustris TaxID=44745 RepID=A0A699YZT6_HAELA) HSP 1 Score: 49.7 bits (117), Expect = 2.150e-5 Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 1 Query: 4 ISSLHIVSADLDGPIPECICMFTQLSVLVIHSCNASGPFPFWI----------DALAG--LQKLDLSDNRLTGTV 192 ++++HI +LDGP+P C L + +GP P W+ L G +Q+LDLS NRL+GT+ Sbjct: 60 LTTVHITDVNLDGPVPRQFCALRNLREFDLDGGQLTGPIPRWLLEPNPDPAANGTLCGSNIQELDLSSNRLSGTI 134
BLAST of mRNA_D-dudresnayi_contig9988.28793.1 vs. uniprot
Match: A0A383VI45_TETOB (Uncharacterized protein n=1 Tax=Tetradesmus obliquus TaxID=3088 RepID=A0A383VI45_TETOB) HSP 1 Score: 48.5 bits (114), Expect = 5.630e-5 Identity = 26/68 (38.24%), Postives = 38/68 (55.88%), Query Frame = 1 Query: 4 ISSLHIVSADLDGPIPECICMFTQLSVLVIHSCNA----SGPFPFWIDALAGL-QKLDLSDNRLTGTV 192 ++S HI S ++GP+P+ C+ L +GP P WID L ++LDLS+NRLTGT+ Sbjct: 63 VTSSHITSEKVNGPVPKEFCLLNHLREFDFGGREGLGYLTGPIPNWIDNCFPLIEELDLSNNRLTGTL 130 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9988.28793.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9988.28793.1 >prot_D-dudresnayi_contig9988.28793.1 ID=prot_D-dudresnayi_contig9988.28793.1|Name=mRNA_D-dudresnayi_contig9988.28793.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=64bp FISSLHIVSADLDGPIPECICMFTQLSVLVIHSCNASGPFPFWIDALAGLback to top mRNA from alignment at D-dudresnayi_contig9988:642..833+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9988.28793.1 ID=mRNA_D-dudresnayi_contig9988.28793.1|Name=mRNA_D-dudresnayi_contig9988.28793.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=192bp|location=Sequence derived from alignment at D-dudresnayi_contig9988:642..833+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9988:642..833+ >mRNA_D-dudresnayi_contig9988.28793.1 ID=mRNA_D-dudresnayi_contig9988.28793.1|Name=mRNA_D-dudresnayi_contig9988.28793.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=384bp|location=Sequence derived from alignment at D-dudresnayi_contig9988:642..833+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |