mRNA_D-dudresnayi_contig9868.28679.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9868.28679.1 vs. uniprot
Match: A0A6H5L508_9PHAE (BTB domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L508_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.310e-5 Identity = 32/64 (50.00%), Postives = 42/64 (65.62%), Query Frame = 3 Query: 222 MSLYAWGKNTHGQLGVKQDPWPSPGARDAKYRTQQ---QQQQSTHGAKLPRLGTKE-GQGHKPV 401 MSLYAWGKN +GQLGVKQ+P S +R + QQ QQ Q + + P+LG++ GQG +PV Sbjct: 1 MSLYAWGKNNYGQLGVKQEPARSNPSRHQPRQGQQEEEQQVQPVNARRPPKLGSERAGQGQEPV 64 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9868.28679.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9868.28679.1 >prot_D-dudresnayi_contig9868.28679.1 ID=prot_D-dudresnayi_contig9868.28679.1|Name=mRNA_D-dudresnayi_contig9868.28679.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=60bp MSLYAWGKNTHGQLGVKQDPWPSPGARDAKYRTQQQQQQSTHGAKLPRLGback to top mRNA from alignment at D-dudresnayi_contig9868:3147..4019- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9868.28679.1 ID=mRNA_D-dudresnayi_contig9868.28679.1|Name=mRNA_D-dudresnayi_contig9868.28679.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=873bp|location=Sequence derived from alignment at D-dudresnayi_contig9868:3147..4019- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9868:3147..4019- >mRNA_D-dudresnayi_contig9868.28679.1 ID=mRNA_D-dudresnayi_contig9868.28679.1|Name=mRNA_D-dudresnayi_contig9868.28679.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=360bp|location=Sequence derived from alignment at D-dudresnayi_contig9868:3147..4019- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |