mRNA_D-dudresnayi_contig9557.28344.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9557.28344.1 vs. uniprot
Match: A0A6H5JNQ3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNQ3_9PHAE) HSP 1 Score: 92.8 bits (229), Expect = 4.430e-23 Identity = 45/61 (73.77%), Postives = 49/61 (80.33%), Query Frame = 1 Query: 94 MSSQNRSKMGKAFAKMTLSCPQQIAGYALCLQAKSVTG-LERGACDEDFRALKLCFQTAVR 273 MSSQNRSKMG+AFAKMT +CPQQIAGY CLQA S G LERG CDE F+ALK CFQ A + Sbjct: 1 MSSQNRSKMGQAFAKMTTACPQQIAGYGTCLQAASTAGMLERGVCDEQFKALKRCFQQAAK 61 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9557.28344.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9557.28344.1 >prot_D-dudresnayi_contig9557.28344.1 ID=prot_D-dudresnayi_contig9557.28344.1|Name=mRNA_D-dudresnayi_contig9557.28344.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=60bp MSSQNRSKMGKAFAKMTLSCPQQIAGYALCLQAKSVTGLERGACDEDFRAback to top mRNA from alignment at D-dudresnayi_contig9557:2220..3058+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9557.28344.1 ID=mRNA_D-dudresnayi_contig9557.28344.1|Name=mRNA_D-dudresnayi_contig9557.28344.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=839bp|location=Sequence derived from alignment at D-dudresnayi_contig9557:2220..3058+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9557:2220..3058+ >mRNA_D-dudresnayi_contig9557.28344.1 ID=mRNA_D-dudresnayi_contig9557.28344.1|Name=mRNA_D-dudresnayi_contig9557.28344.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=360bp|location=Sequence derived from alignment at D-dudresnayi_contig9557:2220..3058+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |