mRNA_D-dudresnayi_contig10703.777.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Match: A0A6H5JRL1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRL1_9PHAE) HSP 1 Score: 73.9 bits (180), Expect = 1.020e-11 Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 2 Query: 269 QHPLMTLRAGGLPTVYPVEAIRRHVHMWHVC-RTRNLASSDEWLCGRQSTPAVRGGRHVWTHKYK-AGSGSEAA-DTYQLNEHHHGIARDSFL 538 +HP ++L+ G P VYPV+AIRR VHM+H C + ++ SS +CG P G VW H+++ A GS D Y LNE HH +D+F+ Sbjct: 312 RHPTLSLQGRGRPKVYPVQAIRRQVHMYHQCPQHSDVGSSTSQICGESQGPYSGGRDRVWHHRFRLALPGSRNGYDRYLLNEVHHSTNQDTFV 404
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Match: A0A6H5K953_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K953_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 4.590e-9 Identity = 41/101 (40.59%), Postives = 54/101 (53.47%), Query Frame = 2 Query: 272 HPLMTLRAGG--LPTVYPVEAIRRHVHMWHVC-------RTRNLASSDEWLCGRQSTPAVRGGRHVWTHKY---KAGSGSEAADTYQLNEHHHGIARDSFL 538 HP L+ GG +P+VYPV+AIRRHVHM+H+C R N ++ E CG + +GG +VW H Y A S D Y LNEH G +D + Sbjct: 903 HPTYWLQGGGNRVPSVYPVDAIRRHVHMYHLCPVSHFEPRAANTSALAE-TCGLRDDDTGKGG-NVWKHHYILAAAKPPSGQRDAYMLNEHWRGAFQDGVV 1001
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Match: A0A6H5KMA2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KMA2_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.040e-6 Identity = 38/100 (38.00%), Postives = 48/100 (48.00%), Query Frame = 2 Query: 269 QHPLMTLRAG--GLPTVYPVEAIRRHVHMWHVCRTRNLASSDEWL-----CGRQSTPAVRGGRHVWTHKYKAGSGSEAA--DTYQLNEHHHGIARDSFLD 541 QHP L+ G +P+VYP+EAIRRHV M+H C + A+ CG RGG VW H Y+ + + D Y L EH R SF D Sbjct: 318 QHPTYWLQRGVKQVPSVYPIEAIRRHVMMYHHCPGSSFATGVSHTPAPDSCGLHDDHRARGGGKVWKHHYRLAPANPSGPRDAYILKEHW----RSSFQD 413
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Match: A0A6H5K4J5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4J5_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.050e-6 Identity = 35/94 (37.23%), Postives = 47/94 (50.00%), Query Frame = 2 Query: 269 QHPLMTLRAGGL--PTVYPVEAIRRHVHMWHVCRTRNLA------SSDEWLCGRQSTPAVRG-GRHVWTHKYKAGSGSEAA-----DTYQLNEH 508 +HP L+ G P+V+PVEAIRRHVHM+H+C T + +S+ CG + +G G VW H Y + D Y LNEH Sbjct: 331 KHPSYWLQGGAATTPSVFPVEAIRRHVHMYHLCPTSSFEGGRIDDTSESQSCGLRMDDMAKGSGAKVWKHHYNLATAPRDRRHGHRDAYLLNEH 424
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Match: D7FZ46_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZ46_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 1.890e-5 Identity = 29/71 (40.85%), Postives = 38/71 (53.52%), Query Frame = 2 Query: 269 QHPLMTLRAG--GLPTVYPVEAIRRHVHMWHVCRTRNLASSDEWL-----CGRQSTPAVRGGRHVWTHKYK 460 QHP L+ G +P+VYP+EAIRRHV M+H C + A+ CG + RGG VW H Y+ Sbjct: 639 QHPTYWLQGGVKQVPSVYPIEAIRRHVMMYHHCPASSFATGVSHTPAPDSCGLHADHRARGGGKVWKHHYR 709 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10703.777.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10703.777.1 >prot_D-dudresnayi_contig10703.777.1 ID=prot_D-dudresnayi_contig10703.777.1|Name=mRNA_D-dudresnayi_contig10703.777.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=156bp NGPTKNAWALGPGAGEDVEIYRDRTARGQAVLNAHRDLTIGKILYFCRHTback to top mRNA from alignment at D-dudresnayi_contig10703:486..1644- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10703.777.1 ID=mRNA_D-dudresnayi_contig10703.777.1|Name=mRNA_D-dudresnayi_contig10703.777.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=1159bp|location=Sequence derived from alignment at D-dudresnayi_contig10703:486..1644- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10703:486..1644- >mRNA_D-dudresnayi_contig10703.777.1 ID=mRNA_D-dudresnayi_contig10703.777.1|Name=mRNA_D-dudresnayi_contig10703.777.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=936bp|location=Sequence derived from alignment at D-dudresnayi_contig10703:486..1644- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |