mRNA_D-dudresnayi_contig10332.355.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A7S3M2G8_9STRA (Hypothetical protein n=2 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3M2G8_9STRA) HSP 1 Score: 101 bits (252), Expect = 1.880e-25 Identity = 43/66 (65.15%), Postives = 56/66 (84.85%), Query Frame = 3 Query: 129 KSARFNTNIELTSNKVVHNVSLLPGEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 ++ RFN +++ S KVV N++L PGEKV+LCRCW S+KFPLCDG+HGK+NK +GDNLGPVVVTV + Sbjct: 46 RAERFNKIVDVYSPKVVSNITLSPGEKVILCRCWLSSKFPLCDGSHGKHNKATGDNLGPVVVTVSQ 111
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A482V1K5_9ARCH (CDGSH iron-sulfur domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482V1K5_9ARCH) HSP 1 Score: 98.6 bits (244), Expect = 2.660e-24 Identity = 40/65 (61.54%), Postives = 53/65 (81.54%), Query Frame = 3 Query: 132 SARFNTNIELTSNKVVHNVSLLPGEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 +AR N ++L+S KVV+ +SL PGEK V+CRCW+S+KFP CDGAH +NK +GDNLGP ++TVPK Sbjct: 46 NARINQKVDLSSEKVVNTISLKPGEKYVVCRCWQSSKFPACDGAHAAHNKRTGDNLGPCIITVPK 110
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: L1J777_GUITC (ZnF_CDGSH domain-containing protein n=2 Tax=Guillardia theta TaxID=55529 RepID=L1J777_GUITC) HSP 1 Score: 85.9 bits (211), Expect = 7.370e-20 Identity = 36/65 (55.38%), Postives = 48/65 (73.85%), Query Frame = 3 Query: 132 SARFNTNIELTSNKVVHNVSLLPGEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 S + N IEL + KV ++ PG+KVV CRCW+SA FP CDGAH K+N+ +GDN+GP++V VPK Sbjct: 2 SGKINHKIELDNPKVATTDTIEPGQKVVYCRCWKSATFPKCDGAHNKHNQETGDNVGPLIVNVPK 66
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A4Y2TIV6_ARAVE (CDGSH iron-sulfur domain-containing protein 1 n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2TIV6_ARAVE) HSP 1 Score: 84.7 bits (208), Expect = 5.100e-19 Identity = 37/63 (58.73%), Postives = 48/63 (76.19%), Query Frame = 3 Query: 129 KSARFNTNIELTSNKVVHNVSLLP-GEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVV 314 K R NT I+L SNKVVH+V + G+K V CRCW+S KFP CDG+H K+N+ SGDN+GP++V Sbjct: 32 KKKRVNTKIQLDSNKVVHSVDIEDVGKKTVFCRCWKSDKFPYCDGSHNKHNECSGDNVGPLIV 94
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A7S2UEE3_9STRA (Hypothetical protein n=1 Tax=Attheya septentrionalis TaxID=420275 RepID=A0A7S2UEE3_9STRA) HSP 1 Score: 83.6 bits (205), Expect = 1.450e-18 Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 3 Query: 138 RFNTNIELTSNKVVHNVSLLPGEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 R NT ++L S KV L PG K V CRCW+S FPLCDG+H K+N+ +GDN+GP++V+VPK Sbjct: 35 RINTQVDLDSPKVATMEKLEPGTKKVYCRCWQSGTFPLCDGSHMKHNEATGDNVGPLIVSVPK 97
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A7S2TZX7_9EUKA (Hypothetical protein n=1 Tax=Lotharella oceanica TaxID=641309 RepID=A0A7S2TZX7_9EUKA) HSP 1 Score: 83.6 bits (205), Expect = 5.470e-18 Identity = 36/63 (57.14%), Postives = 45/63 (71.43%), Query Frame = 3 Query: 138 RFNTNIELTSNKVVHNVSLLPGEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 R NT ++L S KVV L GEK V CRCW+S FPLCDG H K+NK +GDN+GP++V+ PK Sbjct: 86 RINTEVDLESPKVVTMEDLGKGEKKVFCRCWKSGTFPLCDGTHAKWNKETGDNVGPLIVSGPK 148
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: UPI000C77E8C3 (omega-amidase NIT2-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77E8C3) HSP 1 Score: 87.0 bits (214), Expect = 7.870e-18 Identity = 38/62 (61.29%), Postives = 48/62 (77.42%), Query Frame = 3 Query: 132 SARFNTNIELTSNKVVHNVSLLP-GEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVV 314 + R NT +L S+KVV V L G++ V CRCW+SAKFPLCDG+HGKYNKG GDNLGP+++ Sbjct: 287 ATRLNTRYKLESSKVVDTVDLEDLGKRTVYCRCWQSAKFPLCDGSHGKYNKGCGDNLGPLII 348
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A5A9NJS8_9TELE (CDGSH iron-sulfur domain-containing protein 1 n=1 Tax=Triplophysa tibetana TaxID=1572043 RepID=A0A5A9NJS8_9TELE) HSP 1 Score: 81.6 bits (200), Expect = 1.780e-17 Identity = 34/62 (54.84%), Postives = 46/62 (74.19%), Query Frame = 3 Query: 135 ARFNTNIELTSNKVVHNVSLLP-GEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVT 317 +R N I + S KVVH+ + G KV+ CRCWRS KFP CDG+HGK+NK +GDN+GP+++T Sbjct: 56 SRINQTINIDSPKVVHSFDVEDMGNKVIYCRCWRSKKFPYCDGSHGKHNKETGDNIGPLIIT 117
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A7LPG5_CAEEL (ZnF_CDGSH domain-containing protein n=2 Tax=Caenorhabditis elegans TaxID=6239 RepID=A7LPG5_CAEEL) HSP 1 Score: 81.3 bits (199), Expect = 2.930e-17 Identity = 36/67 (53.73%), Postives = 48/67 (71.64%), Query Frame = 3 Query: 129 KSARFNTNIELTSNKVVHNVSLLP-GEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVVTVPK 326 +SAR N I+L SNK+V V + GEK CRCW+S K+P CDG+HGK+NK +GDN+GP++V K Sbjct: 67 RSARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVKSEK 133
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Match: A0A2G9TYI1_TELCI (Zinc finger CDGSH type (Fragment) n=1 Tax=Teladorsagia circumcincta TaxID=45464 RepID=A0A2G9TYI1_TELCI) HSP 1 Score: 79.0 bits (193), Expect = 5.000e-17 Identity = 35/64 (54.69%), Postives = 47/64 (73.44%), Query Frame = 3 Query: 126 IKSARFNTNIELTSNKVVHNVSLLP-GEKVVLCRCWRSAKFPLCDGAHGKYNKGSGDNLGPVVV 314 ++ AR N I+L+++KVV V + GEK CRCW+S KFP CDGAH K+NK +GDN+GP+VV Sbjct: 7 MRRARVNAKIQLSNDKVVDTVDVEDIGEKKAFCRCWKSEKFPYCDGAHSKHNKETGDNVGPLVV 70 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10332.355.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10332.355.1 >prot_D-dudresnayi_contig10332.355.1 ID=prot_D-dudresnayi_contig10332.355.1|Name=mRNA_D-dudresnayi_contig10332.355.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=109bp MISIVLSSKLFVNTPRRLFKKTQPTTLFLSTQGDTIKDANPIKSARFNTNback to top mRNA from alignment at D-dudresnayi_contig10332:8557..8926+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10332.355.1 ID=mRNA_D-dudresnayi_contig10332.355.1|Name=mRNA_D-dudresnayi_contig10332.355.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=370bp|location=Sequence derived from alignment at D-dudresnayi_contig10332:8557..8926+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10332:8557..8926+ >mRNA_D-dudresnayi_contig10332.355.1 ID=mRNA_D-dudresnayi_contig10332.355.1|Name=mRNA_D-dudresnayi_contig10332.355.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=654bp|location=Sequence derived from alignment at D-dudresnayi_contig10332:8557..8926+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |