Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_1032.10.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR003034 | SAP domain | SMART | SM00513 | sap_9 | coord: 23..57 e-value: 8.7E-8 score: 41.9 coord: 109..143 e-value: 5.9 score: 10.8 coord: 152..186 e-value: 0.048 score: 22.8 |
IPR003034 | SAP domain | PFAM | PF02037 | SAP | coord: 28..57 e-value: 1.3E-8 score: 34.4 |
IPR003034 | SAP domain | PROSITE | PS50800 | SAP | coord: 152..186 score: 9.207047 |
IPR003034 | SAP domain | PROSITE | PS50800 | SAP | coord: 23..57 score: 11.284519 |
IPR036361 | SAP domain superfamily | GENE3D | 1.10.720.30 | SAP domain | coord: 11..70 e-value: 3.7E-10 score: 41.2 |
IPR036361 | SAP domain superfamily | SUPERFAMILY | 68906 | SAP domain | coord: 23..59 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 68..82 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 83..97 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 54..102 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-australica_Contig_1032.10.1 ID=prot_C-australica_Contig_1032.10.1|Name=mRNA_C-australica_Contig_1032.10.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=193bp ADGDGDSIEEGAEEKVYIGGEAVDDMLVATLRAHLEDFGLPTGGRKAQLL QRLKEALASSAQGEDPAAQPLEEDKGEQGLEKDEGEQDLEEEGVDEEEPL ELKYKGELIASMSLKAAQQHLRDWGLNHQGRKAAVLERLTAVAVGMSGST YLEGLSAAELRAHLAALGESAAGSKAVMRARLSDAVSRQAEEE back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|