prot_C-tenellus_contig10548.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10548.1.1 vs. uniprot
Match: D7FIZ8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIZ8_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 2.570e-12 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 1 SDSLWVLDRCVKSVLCGRRERKSAEERWIARLADTCANYEAKIKVM 46 SD LW LDRCV SVL GRRERK AEE W +L TCA+YEAKIK + Sbjct: 391 SDCLWTLDRCVASVLEGRRERKQAEEDWTKKLEKTCADYEAKIKAI 436
BLAST of mRNA_C-tenellus_contig10548.1.1 vs. uniprot
Match: A0A6H5KYI7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYI7_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.570e-12 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 1 SDSLWVLDRCVKSVLCGRRERKSAEERWIARLADTCANYEAKIKVM 46 SD LW LDRCV SVL GRRERK AEE W +L TCA+YEAKIK + Sbjct: 390 SDCLWTLDRCVASVLEGRRERKQAEEDWTKKLEKTCADYEAKIKAI 435 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10548.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10548.1.1 ID=prot_C-tenellus_contig10548.1.1|Name=mRNA_C-tenellus_contig10548.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=46bpback to top |