prot_C-tenellus_contig8645.5.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Match: A0A6H5JJT4_9PHAE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJT4_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 1.020e-6 Identity = 24/54 (44.44%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 11 VQITAIYTDYLKAFPKEITQVDNQLVLYTGSMLVGLPYSTTTQSTSVHLGSKEV 64 V++ A+YTD L AFPKEITQ++ Q V++ ++L PY T Q+T++ L S ++ Sbjct: 128 VRVKAVYTDVLTAFPKEITQLEEQSVVFASTLLAPSPYKTVKQTTTLKLASPKI 181
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Match: A0A3M6VLJ8_9STRA (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 n=1 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VLJ8_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 1.460e-6 Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 11 VQITAIYTDYLKAFPKEITQVDNQLVLYTGSMLVGLPYSTTTQSTSVHLGSKEV 64 V++TA +T LK +P EITQVD+QLVL+ S LV PY T TQ+T + L S V Sbjct: 117 VKVTAYFTRVLKPYPAEITQVDDQLVLFNTSHLVISPYLTKTQTTKLKLPSNSV 170
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Match: D7FKM8_ECTSI (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKM8_ECTSI) HSP 1 Score: 53.1 bits (126), Expect = 2.730e-6 Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 11 VQITAIYTDYLKAFPKEITQVDNQLVLYTGSMLVGLPYSTTTQSTSVHLGSKEV 64 + + A+YTD L AFPKEITQ++ Q V++ ++L PY T Q+T++ L S ++ Sbjct: 119 IAVKAVYTDVLTAFPKEITQLEEQSVVFASTLLAPSPYKTVKQTTTLKLASPKI 172
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Match: M4B1W3_HYAAE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4B1W3_HYAAE) HSP 1 Score: 49.7 bits (117), Expect = 4.550e-5 Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 0 Query: 11 VQITAIYTDYLKAFPKEITQVDNQLVLYTGSMLVGLPYSTTTQSTSVHLGSKEV 64 V++TA +T L +P EITQ ++QLVL+ S LV PY T TQ+T + L S +V Sbjct: 115 VKVTAYFTRVLTPYPAEITQQEDQLVLFEASYLVSSPYLTKTQTTKLKLPSGKV 168
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Match: U5D4I6_AMBTC (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 n=1 Tax=Amborella trichopoda TaxID=13333 RepID=U5D4I6_AMBTC) HSP 1 Score: 49.7 bits (117), Expect = 4.630e-5 Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 0 Query: 11 VQITAIYTDYLKAFPKEITQVDNQLVLYTGSMLVGLPYSTTTQSTSVHLGSKEV 64 +++ ++YT LK FP+EITQ DNQLVLY S PY QS S+ + S V Sbjct: 125 LEVFSVYTHSLKPFPEEITQADNQLVLYQDSAYYLSPYDVKVQSLSIRVPSPRV 178 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8645.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8645.5.1 ID=prot_C-tenellus_contig8645.5.1|Name=mRNA_C-tenellus_contig8645.5.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=79bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|