prot_C-tenellus_contig8321.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8321.1.1 vs. uniprot
Match: A0A6H5KBR4_9PHAE (Protein CASP (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBR4_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 9.420e-11 Identity = 46/82 (56.10%), Postives = 60/82 (73.17%), Query Frame = 0 Query: 174 RLGIVTPEHQEAGMTGHERKERRKIRNRMSAQQHRERQRRHVETLEQCLREKDDQILSLKKQAQELEEKNKNLEERVQKLEA 255 ++ ++ P M+ ERKERRKIRNRMSAQQHRERQR+ V+TLE CLR +D++I L+KQ L E+NK L ERV +LE+ Sbjct: 212 KISVLAPSSFGGDMSTQERKERRKIRNRMSAQQHRERQRQRVDTLEDCLRLRDNEIAKLEKQVASLTERNKELAERVLQLES 293 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8321.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8321.1.1 ID=prot_C-tenellus_contig8321.1.1|Name=mRNA_C-tenellus_contig8321.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=539bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|